Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.130 produits)
- Par Biological Target(99.159 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.747 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
USP26 antibody
<p>USP26 antibody was raised in rabbit using the middle region of USP26 as the immunogen</p>Degré de pureté :Min. 95%Peptide5
CAS :<p>Peptide5 is a peptide that has been shown to have anti-inflammatory, neuroprotective, and anticancer properties. It also has the ability to alter calcium binding in vivo, which is associated with brain functions. Peptide5 has been shown to inhibit the growth of cancer cells by blocking uptake of amino acids into cells and tumor growth factor (TGF) production. The peptide can be used as an antigen for the production of monoclonal antibodies designed to treat infectious diseases and inflammatory disorders.</p>Formule :C60H98N16O20SDegré de pureté :Min. 95%Masse moléculaire :1,395.6 g/molALDH1B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1B1 antibody, catalog no. 70R-3238</p>Degré de pureté :Min. 95%EPB49 antibody
<p>EPB49 antibody was raised in rabbit using the middle region of EPB49 as the immunogen</p>PTPN2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPN2 antibody, catalog no. 70R-6410</p>Degré de pureté :Min. 95%Mouse anti Rat IgG (H + L) (HRP)
<p>Rat IgG antibody was raised in mouse using Rat IgG (H + L) as the immunogen.</p>Degré de pureté :Min. 95%DAPP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAPP1 antibody, catalog no. 70R-3869</p>Degré de pureté :Min. 95%GPR161 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR161 antibody, catalog no. 70R-6532</p>Degré de pureté :Min. 95%TBCB antibody
<p>TBCB antibody was raised in rabbit using the N terminal of Tbcb as the immunogen</p>Degré de pureté :Min. 95%OSBPL11 antibody
<p>OSBPL11 antibody was raised in rabbit using the C terminal of OSBPL11 as the immunogen</p>Degré de pureté :Min. 95%Neurokinin B protein (His tag)
<p>17-121 amino acids: MGSSHHHHHH SSGLVPRGSH QSFGAVCKEP QEEVVPGGGR SKRDPDLYQL LQRLFKSHSS LEGLLKALSQ ASTDPKESTS PEKRDMHDFF VGLMGKRSVQ PDSPTDVNQE NVPSFGILKY PPRAE</p>Degré de pureté :Min. 95%KCNK15 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK15 antibody, catalog no. 70R-5222</p>Degré de pureté :Min. 95%Tektin 4 antibody
<p>Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ</p>ATP6V1B1 antibody
<p>The ATP6V1B1 antibody is a highly specialized medicament used in the field of Life Sciences. It is an affinity ligand that specifically targets and binds to the ATP6V1B1 protein. This antibody has been extensively studied for its potential anti-thrombotic properties and its ability to inhibit the activity of adeno-associated virus (AAV). Additionally, it has shown promising results in the treatment of certain diseases affecting the retina, where it acts as an inhibitor of nuclear intermediates. The ATP6V1B1 antibody is a valuable tool for researchers and scientists working in the field of molecular biology, as well as for those involved in drug discovery and development. Its high specificity and efficacy make it an essential component in various experimental protocols and assays.</p>OAS1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OAS1 antibody, catalog no. 70R-5884</p>Degré de pureté :Min. 95%Pancreatic Lipase antibody
<p>The Pancreatic Lipase antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to pancreatic lipase, an enzyme involved in the digestion and absorption of dietary fats. This antibody can be used for various applications such as immunoassays, immunohistochemistry, and western blotting.</p>TP63 antibody
<p>The TP63 antibody is a highly specialized product used in the field of Life Sciences. It is commonly used as a research tool in various experiments and studies. This antibody specifically targets the TP63 protein, which plays a crucial role in cell cycle regulation, development, and differentiation.</p>Sh3glb1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sh3glb1 antibody, catalog no. 70R-9617</p>Degré de pureté :Min. 95%FOXP1 antibody
<p>The FOXP1 antibody is a highly specialized product used in Life Sciences research. It is designed to detect and neutralize autoantibodies that target the FOXP1 protein. This antibody is produced using advanced techniques and has been validated for its high specificity and sensitivity.</p>Degré de pureté :Min. 95%MYD88 Blocking Peptide
<p>The MYD88 Blocking Peptide is a highly specialized product designed to inhibit the activity of MYD88, an important signaling molecule involved in immune responses. This peptide is commonly used in research laboratories and life sciences experiments that focus on studying the function of MYD88.</p>Degré de pureté :Min. 95%γ tubulin antibody
<p>The Gamma tubulin antibody is a highly specific monoclonal antibody that targets the gamma tubulin protein, an essential component of the microtubule organizing center (MTOC). This antibody is widely used in Life Sciences research for various applications, including immunofluorescence assays and Western blotting. It has been proven to be effective in detecting gamma tubulin in different samples, such as adipose tissue, collagen matrices, and human serum.</p>ZNF648 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF648 antibody, catalog no. 70R-8880</p>Degré de pureté :Min. 95%GSK3179106
CAS :<p>GSK3179106 is a potent and selective inhibitor of the enzyme GSK3. It has been shown to have effects on acetylcholine levels, which may be due to its ability to modulate choline uptake. GSK3179106 has also been shown to inhibit cancerous growth by blocking the activation of the EGFR mutant in ganglion cells. This drug binds with high affinity to the receptor for acetylcholine at the neuromuscular junction and blocks neuronal function.</p>Formule :C22H21F4N3O4Degré de pureté :Min. 95%Masse moléculaire :467.41 g/molPBEF1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PBEF1 antibody, catalog no. 70R-1028</p>Degré de pureté :Min. 95%ZFP42 antibody
<p>ZFP42 antibody was raised in rabbit using the N terminal of ZFP42 as the immunogen</p>Degré de pureté :Min. 95%OR2T29 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2T29 antibody, catalog no. 70R-9905</p>Degré de pureté :Min. 95%SCR130
CAS :<p>SCR130 is a protein inhibitor that has shown promising results in the treatment of tumors and cancers. It works by inhibiting kinases, which are enzymes that play a key role in cell signaling pathways. By blocking these pathways, SCR130 can induce apoptosis (cell death) in cancer cells, effectively halting their growth and spread. This medicinal compound is an analog of a Chinese herbal medicine and is excreted through urine. SCR130 has been found to be highly effective against a range of human cancer cell lines and has shown potential as an anticancer drug. Its kinase inhibition properties make it a promising candidate for further development as a targeted therapy for cancer patients.</p>Formule :C19H13Cl2N3O2SDegré de pureté :Min. 95%Masse moléculaire :418.3 g/molPTPN11 antibody
<p>PTPN11 antibody was raised in rabbit using the N terminal of PTPN11 as the immunogen</p>Degré de pureté :Min. 95%TMEM63C antibody
<p>TMEM63C antibody was raised using the middle region of TMEM63C corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM</p>Degré de pureté :Min. 95%9-(3-Hydroxypropoxy)guanine
CAS :<p>9-(3-Hydroxypropoxy)guanine is an aldehyde oxidase inhibitor that blocks the production of formaldehyde, which is a reactive metabolite that can cause DNA damage. 9-(3-Hydroxypropoxy)guanine has been shown to inhibit the oxidation of purines in incubations with c1-6 alkyl. It also inhibits the oxidation of guanine and deoxyguanine mediated by aldehyde oxidase. This drug is a prodrug, which is converted to its active form in the cytosol by cytochrome p450 enzymes. The metabolic transformation of 9-(3-hydroxypropoxy)guanine into its active form occurs primarily in hepatocytes. 9-(3-Hydroxypropoxy)guanine has been shown to be effective against oxidative stress induced by homogenates and liver cells from humans, as well as cytosolic extracts from human hepatocytes.</p>Formule :C8H11N5O3Degré de pureté :Min. 95%Masse moléculaire :225.2 g/molBMP7 antibody
<p>BMP7 antibody was raised in mouse using recombinant human BMP-7/OP-1 as the immunogen.</p>Somatostatin antibody
<p>The Somatostatin antibody is a highly effective solution for various medical applications. This colloidal antibody has been specifically designed to target and neutralize somatostatin, a hormone that regulates the secretion of other hormones in the body. By blocking somatostatin, this antibody promotes the release of important growth factors and hormones such as alpha-fetoprotein, TGF-beta, adiponectin, and epidermal growth factor.</p>
