Produits biochimiques et réactifs

<p>Affinity purified Rabbit polyclonal BCL2L3 antibody</p>

<p>Complement C1r antibody was raised in sheep using human C1r as the immunogen.</p>

<p>Phox-I2 is an advanced chemical reagent, meticulously synthesized from phosphorus oxychloride, operating through a halogenation mechanism. This reagent is particularly significant in the realm of organic chemistry, where it efficiently converts various substrates through iodine incorporation. Known for its unique ability to facilitate halogen transfer, it ensures precise iodination which is crucial for subsequent synthetic manipulations.</p>

<p>RSV antibody was raised in mouse using nucleoprotein of RSV as the immunogen.</p>

<p>Pomalidomide is an immunomodulatory agent that inhibits transcriptional regulation by interacting with the pomalidomide-binding protein, which prevents its interaction with RNA polymerase II and thereby prevents DNA transcription. The study with U266 cells demonstrated that pomalidomide targets CRBN, part of an E3 ligase complex, and inhibits its autoubiquinitation and supresses a critical gene (IRF4, interferon regulatory factor 4) for myeloma cell growth with concentrations up to 10 μM.In vitro assays have shown that pomalidomide has inhibitory effects on cell signaling pathways, such as the NF-κB pathway. Pomalidomide also decreases the production of proinflammatory cytokines, such as TNFα and IL-1β, by inhibiting their synthesis or their release from activated monocytes. Recently, the promoting effect of pomalidomide, as its analog lenalidomide, on erythropoiesis (production of red blood cells) has been investigated, demonstrating positive results for its use as a potential new therapy agent for β-hemoglobinopathies.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is particularly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The potency of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The Testosterone monoclonal antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is specifically designed to target testosterone, a hormone found in both males and females.</p>

<p>Goat anti-rat IgG (H+L) (Fab'2) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>H-YRNIEFFTKNSAFPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YRNIEFFTKNSAFPK-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YRNIEFFTKNSAFPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YRNIEFFTKNSAFPK-OH at the technical inquiry form on this page</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

Ibrutinib is a small-molecule inhibitor of Bruton’s tyrosine kinase, a crucial enzyme to the B-cell receptor pathway. Bruton’s tyrosine kinase becomes continuously activated in B-cell cancers and therefore promotes the survival of tumor cells. Ibrutinib binds irreversibly and covalently to a cysteine residue within the ATP-binding site of the enzyme, thus preventing ATP binding and downstream signal transduction. The ability of Ibrutinib to inhibit Bruton’s tyrosin kinase and hence the B-cell receptor pathway it can be used in the treatment of some B cell cancers such as diffuse large B-cell lymphoma (DLBCL) and chronic lymphocytic leukemia (CLL).

<p>Zika virus NS1 protein is a cytotoxic protein that plays a crucial role in the pathogenesis of Zika virus infection. It has been shown to interact with various molecules and cellular processes, including oncostatin, angptl3, e-cadherin expression, β-catenin, taxol, and osteopontin. This recombinant protein is widely used in the field of Life Sciences for research purposes, such as hybridization studies and monoclonal antibody development. The Zika virus NS1 protein is highly activated and can induce significant cellular responses. Its study provides valuable insights into the mechanisms of Zika virus infection and potential therapeutic targets.</p>

<p>H-HMTEVVRRC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HMTEVVRRC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HMTEVVRRC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HMTEVVRRC-OH at the technical inquiry form on this page</p>

<p>Inhibitor of protein kinase CK2</p>

<p>Bovine Serum Albumin (BSA) is widely used in biochemical and laboratory applications. It is used as a blocking agent in Western blotting, ELISA, and immunohistochemistry to prevent non-specific binding. As well as being a protein standard in protein quantification assays (e.g., Bradford and Lowry assays), this widely used reagent can be used in enzyme reactions to stabilize proteins and prevent denaturation. It can also be used as a nutrient supplement in cell culture media.<br>Cymit Quimica now offers an animal-free BSA product, called StabolyTM. Visit our product page today.</p>

<p>NAP is a neuroprotective peptide, which is derived from activity-dependent neuroprotective protein (ADNP), with a mechanism involving microtubule stabilization and neuronal protection. It exhibits the ability to protect neurons from various types of damage, including oxidative stress and conditions mimicking neurodegenerative diseases. NAP enhances axonal transport and increases the resilience of neurons to insults that would typically result in cell death. This peptide has shown promise in preclinical studies for its potential to halt or reverse cognitive decline, making it a focal point for research into therapeutic strategies for disorders like Alzheimer's disease and other tauopathies. The peptide operates by binding to microtubules, promoting stability, and facilitating efficient transport of cellular components. Studies have highlighted its role in traversing the blood-brain barrier, which makes it a viable candidate for central nervous system-targeted therapies. Researchers continue to explore its efficacy and possible applications in improving cognitive function and providing neuroprotection in aging populations.</p>

<p>Progesterone 11 antibody was raised in rabbit using progesterone 11 as the immunogen.</p>

<p>H-VMNVPDFDFPPEFYEHAKAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VMNVPDFDFPPEFYEHAKAL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VMNVPDFDFPPEFYEHAKAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VMNVPDFDFPPEFYEHAKAL-OH at the technical inquiry form on this page</p>

<p>Endoglin is a protein that is encoded by the ENG gene and is expressed in most tissues. It has been shown to be an antagonist of angiopoietin-1 and angiopoietin-2, which are proteins that regulate the growth of blood vessels and act as a tumor suppressor. Endoglin has also been found to be expressed in neoplastic cells, including cancer cells. The physiological role of endoglin is not well understood, but it may play a role in cell migration and invasion, angiogenesis, or other cellular functions.</p>

<p>The CD133 antibody is a monoclonal antibody that has neutralizing properties. It targets the CD133 protein, which is found on the surface of various cell types including adipocytes and endothelial cells. The CD133 antibody inhibits the activity of phosphatase, an enzyme involved in cellular signaling pathways. By blocking phosphatase activity, the CD133 antibody can modulate cell growth and differentiation.</p>

6-Thioguanine is a purine analog used in the therapy for leukemia and for remission consolidation in patients with acute nonlymphocytic anemia. This drug also has antimetabolite action. It replaces guanine during DNA replication. This substitution disrupts the accurate pairing of DNA bases, leading to errors in DNA replication and hinders cell division.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

<p>Donkey anti-rabbit IgG (H + L) (Fab'2) (Alk Phos) was raised in donkey using rabbit IgG (H&amp;L) as the immunogen.</p>

<p>The Leptin antibody is a monoclonal antibody that targets leptin, a hormone involved in regulating energy balance and body weight. Leptin antibody binds to leptin receptors and blocks their activity, thereby reducing the effects of leptin signaling. This antibody has been used in research studies to investigate the role of leptin in various physiological processes, including metabolism, reproduction, and immune function. Additionally, it has potential therapeutic applications for conditions such as obesity and metabolic disorders. The Leptin antibody is widely used in Life Sciences research and offers valuable insights into the mechanisms underlying leptin signaling pathways.</p>

<p>Peptide H-ENLQFSAALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>C-reactive protein depleted normal human serum</p>

<p>H-CGGESPHSKRPFSQGS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGESPHSKRPFSQGS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGESPHSKRPFSQGS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGESPHSKRPFSQGS-OH at the technical inquiry form on this page</p>

<p>Peptide H-FYVQALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NAVPITPTLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>H-EAAFGPGTGPIWLNEIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EAAFGPGTGPIWLNEIK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EAAFGPGTGPIWLNEIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EAAFGPGTGPIWLNEIK-OH at the technical inquiry form on this page</p>

<p>CYP2C19 antibody was raised using the middle region of CYP2C19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD</p>

<p>Topoisomerase II inhibitor; daunorubicin analog; anti-leukemic; anthracycline</p>

<p>Peptide H-VTSPNITVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The HRP2 antibody is a highly specialized antibody used in the field of Life Sciences. It is widely used in immunoassays for the detection and quantification of specific proteins. This monoclonal antibody has been extensively studied and proven to have high specificity and affinity for its target protein.</p>

<p>Inhibits anti-apoptotic proteins Bcl-2, Bcl-xl and Bcl-w. Synergistic with chemotherapy and radiotherapy in several tumour cell lines. Potent activity as a single agent in lymphoid cancer and small cell lung cancer (SCLC) cell lines. Causes tumour regression in SCLC xenograft tumour in vivo.</p>

<p>Peptide H-EGVVHGVATVAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Streptococcus Pneumoniae antibody was raised in mouse using the Streptococcus pneumoniae common C-polysaccharide as the immunogen.</p>

<p>Inhibits RNAPII-mediated trasncription; immunosuppressant; anti-inflammatory</p>

<p>AFP antibody was raised in mouse using highly pure hAFP from cord serum as the immunogen.</p>

<p>Ac-VHVHVGVHVH-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-VHVHVGVHVH-NH2 is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-VHVHVGVHVH-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-VHVHVGVHVH-NH2 at the technical inquiry form on this page</p>

<p>Signal transducers and activators of transcription 1 (STAT1) binding peptide. STAT1 is a biotinylated protein that contains an SH2 domain, which binds to specific phospho (pY)-containing peptide motifs. Interferon &amp;γ- (IFN&amp;γ-/type II IFN) activates STAT1 by its phosphorylation. STAT1 is a critical mediator of cytokine signalling and has been reported as a tumour suppressor in breast cancer, myeloma and leukaemia.IFN&amp;γ- is secreted by immune cells and signals through the IFN&amp;γ- receptor and downstream signalling pathways including the janus kinase (JAK)/STAT pathway. IFN&amp;γ- is a central mediator of the adaptive immune system and regulates macrophage activation to promote the expression of high levels of pro-inflammatory cytokines (Il-1β, IL-12, IL-23, and TNF-α)- production of reactive nitrogen and oxygen intermediates- promotion of CD4+ T helper 1 (Th1) cell response and strong inflammatory activity. IFN&amp;γ- inhibits viral replication and is essential for vaccine-mediated immune responses. IFN&amp;γ- signalling is usually short-lived to elicit recovery of homeostasis, including tissue repair, however IFN-&amp;γ- is elevated in severe adult asthma and is present in the airways of children with severe asthma. This indicates a key role for IFN&amp;γ- in inflammatory conditions.Peptide contains a phosphorylated tyrosine residue and an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-LGEVNTYAGDLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTDGSTDYGILQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LPPYLYT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPPYLYT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPPYLYT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPPYLYT-OH at the technical inquiry form on this page</p>