Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.118 produits)
- Par Biological Target(99.156 produits)
- Par usage/effets pharmacologiques(6.788 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.748 produits)
- Métabolites secondaires(14.233 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Serdemetan
CAS :<p>Serdemetan is a potent anticancer drug that works by inhibiting protein kinases, which are enzymes involved in cell signaling pathways. It is an analog of a natural product found in Chinese medicinal plants and has been shown to induce apoptosis (cell death) in cancer cells. Serdemetan is a urinary excretion product and has been used as a potential biomarker for cancer diagnosis. This drug has shown promising results as an inhibitor of tumor growth and has been studied extensively for its potential use in cancer therapy. Its ability to selectively target cancer cells while sparing healthy cells makes it an attractive candidate for further research and development.</p>Formule :C21H20N4Degré de pureté :Min. 95%Masse moléculaire :328.4 g/molOTS514 hydrochloride
CAS :<p>OTS514 hydrochloride is an analog inhibitor of adenosine triphosphate (ATP)-competitive kinase, which has been shown to exhibit potent anticancer activity. It selectively inhibits the activity of the serine/threonine kinase AKT1, which is involved in regulating cell growth and survival. OTS514 hydrochloride has been found to induce apoptosis in various human cancer cell lines, including those from breast, colon, and lung cancers. It also exhibits inhibitory effects on polysaccharides that promote tumor growth in Chinese hamster urine. This compound has shown promising results as a potential therapeutic agent for cancer treatment.</p>Formule :C21H21ClN2O2SDegré de pureté :Min. 95%Masse moléculaire :400.9 g/molMPDC
CAS :<p>MPDC is a plant extract from Solanum tuberosum that has shown to have properties that can be used in the treatment of cancer, atherosclerosis, and cardiac diseases. MPDC has been shown to maintain mitochondrial membrane potential and act as an actuator in plants. It also inhibits the transcriptase polymerase chain reaction and suppresses growth factor activity. This extract also contains a number of molecules with anti-inflammatory and anti-atherogenic effects. MPDC has been shown to inhibit the growth of mesenchymal cells, which are responsible for tissue remodeling. It has been found to reduce the diameter of atrial cells in rats by inhibiting angiotensin II type I receptor expression. The extract also contains a number of molecules with anti-inflammatory and anti-atherogenic effects. MPDC has been shown to inhibit the growth of mesenchymal cells, which are responsible for tissue remodeling.</p>Formule :C7H9NO4Degré de pureté :Min. 95%Masse moléculaire :171.15 g/molAcemetacin-d4
CAS :<p>Please enquire for more information about Acemetacin-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C21H18ClNO6Degré de pureté :Min. 95%Masse moléculaire :419.8 g/molChromogranin A (Human, 286-301 Amide)
CAS :<p>Chromogranin A (Human, 286-301 Amide) is a protein that belongs to the class of peptides. It is a major component of the chromaffin granules in the adrenal medulla and in neuroendocrine cells in various parts of the brain. There are two types of chromogranin A, which have 286-301 amino acids. Chromogranin A is an activator for G-protein coupled receptors, ion channels, and ligands. This protein has been used as a research tool in Cell Biology and as an inhibitor in Pharmacology.</p>Formule :C78H123N21O27SDegré de pureté :Min. 95%Masse moléculaire :1,819 g/molFT206
CAS :<p>FT206 is a potent protein kinase inhibitor that has shown great promise in the fight against cancer. This medicinal compound works by targeting specific kinases present in cancer cells and tumors, ultimately leading to apoptosis or programmed cell death. FT206 is a human analog of a Chinese urine compound that has been used for centuries as an anticancer agent. This powerful inhibitor has been found to be effective against a wide range of cancer types, making it a promising candidate for future cancer treatments. In addition, FT206 has been shown to have minimal toxicity in healthy cells, making it an attractive option for cancer therapy. With its ability to selectively target kinases involved in tumor growth and survival, FT206 represents a significant advance in the development of new cancer therapies.</p>Formule :C25H29N5OSDegré de pureté :Min. 95%Masse moléculaire :447.6 g/molEthyl 4-[[3-[2-(3-chlorophenyl)ethyl]-2-pyridinyl]carbonyl]-1-piperidinecarboxylate,4-[[3-[2-(3-chlorophenyl)ethyl]-2-pyridinyl]carb onyl]-1-piperidinecarboxylic acid ethyl ester
CAS :<p>Ethyl 4-[[3-[2-(3-chlorophenyl)ethyl]-2-pyridinyl]carbonyl]-1-piperidinecarboxylate,4-[[3-[2-(3-chlorophenyl)ethyl]-2-pyridinyl]carb onyl]-1-piperidinecarboxylic acid ethyl ester is a potent and selective inhibitor of the ion channels TRPV1 and TRPM8. It has been shown to suppress the production of inflammatory cytokines in human mast cells. This compound is also used as a research tool for studying protein interactions and receptor pharmacology.</p>Formule :C22H25ClN2O3Degré de pureté :Min. 95%Masse moléculaire :400.9 g/molK-Ras G12C-IN-1
CAS :<p>K-Ras G12C-IN-1 is a biopesticide that is used as a nematode, plant, and insecticide. It is also a fungicide and bactericide. K-Ras G12C-IN-1 has been shown to have pesticidal, phytopathogenic, and acaricidal properties. It has been tested on nematodes in the soil and on plants such as rice, wheat, soybeans, corn, and cotton. In addition to its pesticidal properties, it has been shown to improve plant health by preventing the growth of fungi that cause plant diseases such as powdery mildew or rust.</p>Formule :C22H23Cl2N3O3Degré de pureté :Min. 95%Masse moléculaire :448.34 g/molFibronectin Active Fragment (RGDS)
CAS :<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials.</p>Formule :C15H27N7O8CH3COOH•2H2ODegré de pureté :Min. 95%Masse moléculaire :499.48 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Galactopyranosyl Fluoride
CAS :<p>2,3,4,6-Tetra-O-acetyl-α-D-galactopyranosyl fluoride (TATA) is a fluorinated sugar that is used as a building block for the synthesis of peptides and other biochemicals. TATA has been shown to be an inhibitor of bacterial growth in medium containing glycosyl residues. This product has also been shown to have anti-inflammatory properties in animal models.</p>Formule :C14H19O9FDegré de pureté :Min. 95%Masse moléculaire :350.29 g/molNeuropeptide W-30 (Rat)
CAS :<p>Neuropeptide W-30 (Rat) is a peptide that belongs to the family of neuropeptides. It has been identified as an inhibitor of the ion channel TRPV1 and TRPA1, which are involved in pain perception. Neuropeptide W-30 (Rat) also inhibits the activation of phospholipase C, protein kinase C, and cAMP response element binding protein. Neuropeptide W-30 (Rat) is used as a research tool for studying protein interactions and for pharmacological studies.</p>Formule :C165H249N49O38SDegré de pureté :Min. 95%Masse moléculaire :3,559.1 g/molCGRP (Rat)
CAS :<p>CGRP (Rat) product with the disulfide Bonds: Cys2-Cys7 and available as a 0.5mg vial. CGRP is the calcitonin gene-related peptide (CGRP), a neuropeptide that plays an important role in the regulation of vascular tone and blood flow, as well as pain perception, inflammation, and neurogenic inflammation. It is a potent vasodilator and has been implicated in a wide range of physiological and pathophysiological processes.<br>This product has the potential for use in the study of the physiological and pathological roles of CGRP and to investigate the effects of CGRP on blood vessels, neurons, and other tissues. It has also been used to develop models of migraine headaches and other conditions associated with CGRP dysfunction.</p>Degré de pureté :Min. 95%Solcitinib
CAS :<p>Solcitinib is a Jak1 inhibitor that is being evaluated for its potential to treat cancer. The drug inhibits the activity of the Janus kinase 1 (JAK1) enzyme, which is involved in signaling pathways that are important for cell growth and survival. Solcitinib has been shown to inhibit tumor growth in animal models of cancer and has been shown to be well-tolerated in humans with advanced solid tumors who have previously received treatment with other anti-cancer agents. In addition, solcitinib has been shown to reduce inflammation and improve immune function in animal models of inflammatory bowel disease and bowel disease. This drug may also be effective against autoimmune diseases such as alopecia areata or inflammatory bowel disease.</p>Formule :C22H23N5O2Degré de pureté :Min. 95%Masse moléculaire :389.45 g/molPyr-Phe-Leu-pNA
CAS :<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that can be used as a pharmaceutical drug. It has been shown to have insecticidal activity against the Anopheles mosquito and other insects, as well as antimicrobial activity against bacteria and fungi. Pyr-Phe-Leu-pNA is activated by tryptophan fluorescence, which is why it is suitable for use in peptide mapping. This enzyme also has an important physiological function in the zymogen activation pathway, which enables it to act as an enzyme substrate. Pyr-Phe-Leu-pNA will also degrade proteins that contain sequences of leishmania protease activity or signal peptide.</p>Formule :C26H31N5O6Degré de pureté :Min. 95%Masse moléculaire :509.55 g/molNHS-Biotin
CAS :<p>NHS-Biotin is a biotin analog that can be used as an affinity label for the purification of specific proteins. NHS-Biotin is synthesized by reacting monoclonal antibody with lysine residues and a hydroxyl group, which form a covalent bond known as an amide linkage. The NHS-Biotin can then be covalently attached to the protein of interest. This attachment allows the protein to be purified by passing it over a column of immobilized streptavidin. NHS-Biotin has been shown to bind to actin filaments in humans and uptake peptide hormones in the bloodstream. It was also found that human serum contains chemical reactions with NHS-Biotin, forming a disulfide bond between two cysteine residues on the protein.</p>Formule :C28H39F3N6O9Degré de pureté :Min. 95%Masse moléculaire :660.64 g/molDS18561882
CAS :<p>DS18561882 is a mitochondria-targeting drug that can induce apoptotic cell death. It has been shown to be clinically relevant in phase II clinical studies. DS18561882 may be used as a prognostic marker for cancer patients, and it suppresses the expression of genes that promote cell proliferation. This drug also inhibits protein synthesis, which causes apoptosis by targeting the mitochondria. DS18561882 is orally active and can be used as an anticancer agent against solid tumors.</p>Formule :C28H31F3N4O6SDegré de pureté :Min. 95%Masse moléculaire :608.6 g/molZ-Phe-Arg-AMC
CAS :<p>sold as the HCl salt</p>Formule :C33H36N6O6Degré de pureté :Min. 95%Masse moléculaire :612.68 g/molPhysalaemin
CAS :<p>Physalaemin is a peptide that has been found to be an activator of the G-protein coupled receptor. Physalaemin has been shown to inhibit ion channels, such as potassium channels and calcium channels. Physalaemin may also inhibit the activity of certain ligands, such as bradykinin and substance P. This peptide can also act as a research tool for pharmacology and cell biology.</p>Formule :C58H84N14O16SDegré de pureté :Min. 95%Masse moléculaire :1,265.4 g/molAc-Phe-OEt
CAS :<p>Ac-Phe-OEt is a covalently conjugated bifunctional peptide that has been synthesized by linking the amino acid phenylalanine to the amino acid ethyl ester of oleic acid. Ac-Phe-OEt exhibits a high affinity for bacterial serine proteases (Km=0.1 μM) and lysine residues (Ki=4 μM). This peptide also binds to immobilized cytochalasin, which prevents the formation of amyloid fibrils. Ac-Phe-OEt can be used in enzyme catalysis as an inhibitor or competitive inhibitor, as well as being immobilized on surfaces. The kinetic data suggests that Ac-Phe-OEt competes with lysine residues for binding to bacterial serine proteases and inhibits their activity.</p>Formule :C13H17NO3Degré de pureté :Min. 95%Masse moléculaire :235.28 g/mol4-Methoxyphenylazoformyl-Phe
CAS :<p>4-Methoxyphenylazoformyl-Phe is a synthetic molecule that can be used as a research tool in the study of ion channels and ligands. The receptor binding affinity of 4-methoxyphenylazoformyl-Phe is unknown, but it has been shown to activate peptides in living cells. This compound is an inhibitor of ion channels and ligand for G protein coupled receptors. It can be used as a research tool in the study of ion channels and ligands. The receptor binding affinity of 4-methoxyphenylazoformyl-Phe is unknown, but it has been shown to activate peptides in living cells. This compound is an inhibitor of ion channels and ligand for G protein coupled receptors.</p>Formule :C17H17N3O4Degré de pureté :Min. 95%Masse moléculaire :327.33 g/molAdjuvant Peptide
CAS :<p>Adjuvant Peptide is a glycol ether that has been shown to have biological properties. It is used in the production of Immunoassays and other biochemicals. Adjuvant Peptide is an experimental model for immunity, as it stimulates cellular responses and alters the immune system's response to antigens. It shows potential for use in treating bowel diseases, such as ulcerative colitis, because of its ability to stimulate macrophage activity and induce cytokine production.</p>Formule :C19H32N4O11•2H2ODegré de pureté :Min. 95%Masse moléculaire :528.51 g/molDes-Arg10-Kallidin
CAS :Produit contrôlé<p>Kallidin is a peptide that is found in the venom of the Brazilian pit viper (Bothrops jararaca). It has been shown to activate ion channels and receptors. Des-Arg10-Kallidin is a research tool that can be used in cell biology, pharmacology, and life science research. This peptide binds to antibodies and creates an ion channel when it binds to a receptor. Kallidin also inhibits protein interactions by binding to the active site of proteases such as thrombin, trypsin, and cathepsin B. The high purity of this peptide makes it ideal for use in pharmaceuticals.</p>Formule :C50H73N13O11Degré de pureté :Min. 95%Masse moléculaire :1,032.2 g/molElastatinal
CAS :<p>Elastatinal is a research tool that is used to activate cells by binding to a receptor on the cell surface. Elastatinal belongs to the Ligand class of compounds and has been shown to bind to various ion channels and receptors, including cell surface receptors. This ligand binds with high affinity to the α-adrenergic receptor (α-AR) and activates cells that express this receptor. It also inhibits the binding of other ligands, such as bradykinin, which may be useful in pharmacology. Elastatinal is an inhibitor of protein interactions, which can be used in Cell Biology studies.</p>Formule :C21H36N8O7Degré de pureté :Min. 95%Masse moléculaire :512.56 g/molGGTI-2154
CAS :<p>GGTI-2154 is an anticancer drug that has shown promising results in the treatment of various types of tumors. It is a potent inhibitor of geranylgeranyltransferase I (GGTase I), which is an enzyme that plays a crucial role in the signaling pathways involved in cancer cell growth and survival. GGTI-2154 has been shown to induce apoptosis (programmed cell death) in human cancer cells, leading to tumor regression. This drug is an analog of oseltamivir, a medication used to treat influenza, and it can be detected in urine samples after administration. GGTI-2154 targets specific kinases and proteins involved in cancer progression, making it a highly effective inhibitor with minimal side effects.</p>Formule :C24H28N4O3Degré de pureté :Min. 95%Masse moléculaire :420.5 g/molBradykinin (Human, Bovine, Rat, Mouse)
CAS :<p>Bradykinin is a peptide hormone that is produced in the body by the kininase enzyme. It is an activator of ion channels and ligand for the G-protein coupled receptors B1, B2, and B3. Bradykinin is used as a research tool to study cell biology, pharmacology, and life science. It interacts with proteins such as erythrocyte protein band 4.4, alpha-2-macroglobulin receptor, alpha-bungarotoxin binding protein, beta-chain integrin receptor, and platelet membrane glycoprotein IIb/IIIa receptor. Bradykinin has been shown to inhibit the activity of bradykinin B1 receptor (Ki = 0.4 nM) and bradykinin B2 receptor (Ki = 0.6 nM).</p>Formule :C50H73N15O11Degré de pureté :Min. 95%Masse moléculaire :1,060.2 g/molTuftsin
CAS :<p>Tuftsin is a ligand with the ability to activate specific receptors. It is also known as Activator, and is a reagent that can be used in research for cell biology and pharmacology. Tuftsin has been shown to bind to ion channels and act as an inhibitor of these channels. This activity leads to the inhibition of calcium influx into cells, which may be important for regulating cellular processes such as apoptosis, cytoskeletal rearrangement, or protein synthesis. It may also play a role in immune response pathways.</p>Formule :C21H40N8O6Degré de pureté :Min. 95%Masse moléculaire :500.6 g/molFmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH
CAS :<p>Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH is a peptide that belongs to the group of carbohydrate derivatives. It has been shown to inhibit the growth of bacteria and fungi by inhibiting protein synthesis. The amino acid sequence is Ser-Gly-Gly-Gly-Ala-Ser, which has a high affinity for bacterial cell walls. Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH binds to bacterial cell walls by competitive inhibition of the enzyme D, L aminopimelate aminotransferase (EC 2.6.1.19). This binding prevents the formation of an antibiotic inhibitor complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>Formule :C44H52N2O21Degré de pureté :Min. 95%Masse moléculaire :944.88 g/molLeu-NH2 • HCl
CAS :<p>Leu-NH2 • HCl is an imidazolidinone that has been shown to have anti-inflammatory properties. The compound is a highly selective, full agonist at the CB1 receptor and has been shown to be effective in animal models of inflammatory diseases, such as collagen-induced arthritis. Leu-NH2 • HCl also has been shown to inhibit the enzymatic activity of cb1 receptor in food chemistry and c1-6 alkyl atrial receptors. Leu-NH2 • HCl binds to the same site on the receptor as THC (Δ9-tetrahydrocannabinol) and is used in research on Alzheimer's disease. This drug has also been shown to inhibit the enzymatic activity of hyaluronic acid synthetase, which may be related to its pharmacokinetic study.</p>Formule :C6H14N2O•HCIDegré de pureté :Min. 95%Masse moléculaire :166.65 g/molBz-Gly-His-Leu • H2O [Hippuryl-Histidyl-Leucine]
CAS :<p>Bz-Gly-His-Leu is a peptide that has the amino acid sequence of Hippuryl-Histidyl-Leucine. The peptide binds to Angiotensin I Converting Enzyme I Substrates and prevents the enzyme from converting Angiotensin I to Angiotensin II, thereby lowering blood pressure. Bz-Gly-His-Leu has been shown to be effective in reducing blood pressure in patients with congestive heart failure as well as those with normal cardiac function.</p>Formule :C21H27N5O5•H2ODegré de pureté :Min. 95%Masse moléculaire :447.49 g/molBz-DL-Arg-pNA • HCl [DL-BAPA]
CAS :<p>Bz-DL-Arg-pNA • HCl [DL-BAPA] is a trypsin and trypsin-like protease substrate. It is used as a tool in biochemical studies to investigate the degradation of proteins by these enzymes. Bz-DL-Arg-pNA • HCl [DL-BAPA] is also used as an experimental model for diseases that affect enzyme activity, such as rheumatoid arthritis and multiple sclerosis.</p>Formule :C19H22N6O4•HClDegré de pureté :Min. 95%Masse moléculaire :434.88 g/molAntipain
CAS :<p>Antipain is a proteolytic enzyme that hydrolyzes peptide bonds in proteins. It is a member of the papain family of proteases and has been shown to activate peptides and inhibit ion channels, both of which are important for cell biology research. Antipain, an inhibitor of protein synthesis, is also used as a research tool in cell biology and biochemistry.</p>Formule :C27H44N10O6Degré de pureté :Min. 95%Masse moléculaire :604.7 g/molβ-Sheet Breaker Peptide iAß5
CAS :<p>Beta-Sheet Breaker Peptide iAß5 is a peptide that interacts with amyloid beta proteins to disrupt the formation of beta sheets. It has been shown to inhibit the aggregation of amyloid beta proteins into oligomers and fibrils, and disrupts the self-assembly of amyloid beta protein into various conformations. Beta-Sheet Breaker Peptide iAß5 is a ligand for both receptor and activator binding sites on amyloid beta proteins, inhibiting the interaction of these sites. This inhibits the activation of downstream signalling pathways associated with Alzheimer's disease.</p>Formule :C33H43N5O8Degré de pureté :Min. 95%Masse moléculaire :637.72 g/molBRD9539
CAS :<p>BRD9539 is a small molecule modulator, which is a synthetic compound developed to interact with specific biological pathways. It is designed using advanced organic synthesis techniques and computational modeling, aimed at targeting specific molecular functions within cell signaling pathways. The mode of action of BRD9539 involves the inhibition of particular enzymes or protein interactions that are crucial in the regulation of cellular proliferation and survival.</p>Formule :C24H21N3O3Degré de pureté :Min. 95%Masse moléculaire :399.44 g/molAmyloid β-Protein (Human, 1-43)
CAS :<p>Amyloid beta (Aβ) is a peptide that is associated with the development of Alzheimer's disease. It is used as a research tool in cell biology, pharmacology and neuroscience. Amyloid beta-protein has been shown to activate certain receptors on the surface of cells, including ion channels. This protein also binds to antibodies that are specific for Aβ and can be used in immunohistochemistry experiments.</p>Formule :C207H318N56O62SDegré de pureté :Min. 95%Masse moléculaire :4,615.1 g/molBTZ043 Racemate
CAS :<p>BTZ043 is a racemic mixture of two enantiomers, btz043 and btz044. It is an anti-tuberculosis drug that binds to the 50S ribosomal subunit and inhibits protein synthesis by preventing the binding of aminoacyl-tRNA to the ribosome. BTZ043 has been shown to be effective in a pharmacological study on human serum for the treatment of tuberculosis. The pharmacokinetic properties of BTZ043 have been studied in mice, with pharmacokinetic properties similar to those of nitrofurantoin. BTZ043 also has antimicrobial activity against a variety of infectious agents, including malaria, SARS coronavirus, and mycobacterium tuberculosis.br>br></p>Formule :C17H16F3N3O5SDegré de pureté :Min. 95%Masse moléculaire :431.39 g/molGRF (Human)
CAS :<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H358N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,039.7 g/molAlarin
CAS :<p>Alarin is a peptide that is an activator of the nicotinic acetylcholine receptor. It has been shown to activate the receptor in a number of systems, including calf-thymus DNA and purified protein. Alarin binds to the ligand-binding site of the acetylcholine receptor, which leads to channel opening. Alarin has been shown to interact with ion channels and can be used as a research tool for cell biology and pharmacology studies.</p>Formule :C127H205N43O35Degré de pureté :Min. 95%Masse moléculaire :2,894.3 g/molDes-Arg9-[Leu8]-Bradykinin
CAS :Produit contrôlé<p>Bradykinin is a peptide hormone that can be formed from the breakdown of kininogen. It works by binding to specific receptors found on the surface of cells and activating a G-protein coupled receptor. Bradykinin stimulates the secretion of gastric acid, increases the permeability of capillaries in the lungs, and causes contraction of smooth muscle in many organs. Bradykinin also has an important role in regulating blood pressure and heart rate. Des-Arg9-[Leu8]-Bradykinin (D-BK) is a potent inhibitor of this activity and is used as an antihypertensive agent. D-BK prevents the activation of G-proteins by binding to receptors with high affinity and specificity. When it binds to its receptor, it inhibits cyclic AMP production, which leads to decreased cell activity and vasodilation. This inhibition reduces blood pressure by reducing cardiac output and increasing systemic vascular resistance.</p>Formule :C41H63N11O10•CH3COOH•3H2ODegré de pureté :Min. 95%Masse moléculaire :984.11 g/molLH-RH (Human)
CAS :<p>Luteinizing hormone-releasing hormone (LH-RH), also known as Gonadotropin-Releasing Hormone (GnRH), stimulates the pituitary gland’s production and secretion of luteinizing hormone and follicle-stimulating hormone. LHRH is a decapeptide and is itself secreted by the hypothalamus. It is crucial for human reproduction and is heavily involved in the regulation of ovulation, sexual development and the onset of puberty.<br>When secreted, GNRH binds to the G-protein coupled receptor, gonadotropin-releasing hormone receptor (GNRHR) located on pituitary gonadotrophic cells in the anterior pituitary.<br>Medically, the understanding of GnRH is paramount, due to its involvement in the pathogensis of central hypogonadism. Any obstructions to its function in the reproductive system can result in the development of human pathologically conditions. It is important to note that analogs of GnRH can be used in pharmacology, in the treatment of gynaecological diseases, through blocking the secretion of estrogen secretion from the ovary. Additional GNRH analogs can be used to treat ovarian cancer, hormone-dependent cancers, endometriosis and modality in infertility. Therefore this product is a useful research tool and is available in a 0.5mg vial.</p>Formule :C55H75N17O13•(C2H4O2)2Degré de pureté :Min. 95%Masse moléculaire :1,302.4 g/molE-64-c
CAS :<p>E-64-c is a research tool that is used to activate the receptor of a cell. This ligand can bind to the receptor and form a complex, which will then be able to interact with other proteins in the cell. This process can lead to changes in ion channel activity, protein synthesis, or gene expression. E-64-c has been shown to inhibit the activity of ion channels such as calcium channels and potassium channels, as well as protein synthesis. It also binds to antibodies and blocks their binding sites on cells.br><br>E-64-c is a high purity ligand that can be used for studying protein interactions or pharmacological purposes. The potency of this ligand has been tested by measuring its ability to inhibit the binding of various peptides such as vasopressin and angiotensin II.</p>Formule :C15H26N2O5Degré de pureté :Min. 95%Masse moléculaire :314.38 g/molBoc-Leu-Gly-Arg-AMC
CAS :<p>Boc-Leu-Gly-Arg-AMC is a peptide that binds to the receptor for N-methyl-D-aspartate (NMDA) and inhibits the ion channel. It has been used as a research tool to study NMDA receptor interactions, as well as in cell biology and pharmacology. Boc-Leu-Gly-Arg-AMC is a high purity, ionic analog of glutamate that binds to the NMDA receptor without activating it, thereby inhibiting ion flow through the channel. This inhibition can be reversed by adding excess glutamate or glycine. The binding of this compound to the NMDA receptor has been shown to block activation of voltage gated calcium channels and reduce neuronal excitation, which may provide an alternative therapeutic strategy for controlling seizures or other neurological disorders.</p>Formule :C29H43N7O7Degré de pureté :Min. 95%Masse moléculaire :601.69 g/molRIPA-56
CAS :<p>RIPA-56 is an experimental drug that belongs to a class of acyltransferases. It has shown to be effective in preventing the development of tubulointerstitial injury in the experimental model and prevents cytosolic calcium overload by inhibiting phospholipase A2. RIPA-56 also inhibits apoptosis pathways and has been shown to be effective against autoimmune diseases, such as hepatitis B virus-induced hepatic steatosis and toxic epidermal necrolysis. RIPA-56 interacts with toll-like receptor 4 (TLR4) which is a protein that recognizes bacterial lipopolysaccharides on the surface of cells and activates immune response.</p>Formule :C13H19NO2Degré de pureté :Min. 95%Masse moléculaire :221.3 g/molGlucagon-like Peptide 1 (Human 7-37)
CAS :<p>GLP-1 is a peptide hormone that is released by the pancreas in response to food intake. This hormone activates receptors on the L cells of the ileum and duodenum, which causes increased production of insulin and decreased production of glucagon. GLP-1 also decreases appetite, slows gastric emptying, and reduces blood glucose levels by increasing the uptake of glucose into muscle cells. GLP-1 has been shown to be effective in reducing body weight, lowering blood pressure and cholesterol levels, improving glycemic control, and preventing diabetes. The GLP-1 receptor is found in ion channels and cell biology as well as pharmacology.</p>Formule :C151H228N40O47Degré de pureté :Min. 95%Masse moléculaire :3,355.7 g/molSuc-Gly-Pro-AMC
CAS :<p>Suc-Gly-Pro-AMC is a research tool that is used to measure the activation of receptors. It binds to the receptor, which changes its conformation and leads to an ion channel opening. The change in ion concentration alters the voltage across the cell membrane, which can be measured. Suc-Gly-Pro-AMC has been shown to inhibit peptide binding to cells that are sensitive to the peptides, such as those with autoimmune diseases.</p>Formule :C21H23N3O7Degré de pureté :Min. 95%Masse moléculaire :429.42 g/molZ-Asp-CH2-DCB
CAS :<p>Z-Asp-CH2-DCB is a peptide that is an activator of cell membrane ion channels and receptor proteins. It has been shown to inhibit the interaction between ligands and receptors, thus blocking the binding of chemical signals with their corresponding cells. This chemical signal can be either neurotransmitters or hormones. Z-Asp-CH2-DCB is also a research tool for studying protein interactions and cellular processes, such as ion channel activation.</p>Formule :C20H17NO7Cl2Degré de pureté :Min. 95%Masse moléculaire :454.26 g/molBoc-Val-Pro-Arg-AMC
CAS :<p>Boc-Val-Pro-Arg-AMC is a peptide that activates ion channels. It is an agonist of the nicotinic acetylcholine receptor (nAChR) and can be used in research to investigate the pharmacology of nAChRs. Boc-Val-Pro-Arg-AMC can also be used as a high purity ligand for antibody production, which has applications in cell biology and other life science research.</p>Formule :C31H45N7O7Degré de pureté :Min. 95%Masse moléculaire :627.73 g/molc3 Ceramide
CAS :<p>C3 Ceramide is a human-derived analog of the naturally occurring sphingolipid ceramide. It has been shown to induce apoptosis, or programmed cell death, in cancer cells through activation of kinase pathways. C3 Ceramide has been found in human urine and can be used as a potential therapeutic agent for various cancers. This polysaccharide-based inhibitor has demonstrated potent anticancer effects against tumor cells in vitro and in vivo. Additionally, C3 Ceramide has also shown promise as a protein kinase inhibitor, making it a valuable medicinal tool for cancer research and treatment. Its potential benefits are being explored by scientists worldwide, including those from China who are investigating its efficacy against different types of cancer.</p>Formule :C21H41NO3Degré de pureté :Min. 95%Masse moléculaire :355.6 g/molPhe-AMC
CAS :<p>Phen-AMC is a potent inhibitor of the enzyme acetylcholinesterase (AChE), which catalyzes the breakdown of the neurotransmitter acetylcholine. Phen-AMC is used as a research tool to study protein interactions, activator, and ligand binding. This inhibitor also has been shown to activate nicotinic receptors, ion channels, and antibodies.</p>Formule :C19H18N2O3Degré de pureté :Min. 95%Masse moléculaire :322.36 g/molNPY (Porcine, 13-36)
CAS :<p>NPY is a peptide that belongs to the family of neuropeptides. It is an activator of G-protein coupled receptors, which are proteins found on the surface of cells. NPY binds to these receptors and triggers a signal transduction cascade that leads to increased activity in ion channels. This results in an increase in the permeability of the membrane and the influx of calcium ions into cells, which can cause cell death or inhibition of cell growth. NPY has been shown to be involved in many physiological processes, including regulation of food intake, body weight, water balance, reproduction, and immune function. NPY has also been shown to inhibit receptor binding by antibodies.</p>Formule :C135H209N41O36Degré de pureté :Min. 95%Masse moléculaire :2,982.4 g/molOxytocin (Human, Porcine, Bovine, Rat, Ovine)
CAS :<p>Oxytocin is a peptide hormone that is produced by the hypothalamus and released by the pituitary gland. It is used to induce labor, control postpartum bleeding and stimulate milk production. Oxytocin also plays a role in sexual arousal, social recognition, and trust. It has been shown to have an inhibitory effect on many types of ion channels, including those found in the heart, central nervous system, and blood vessels. Oxytocin binds to receptors that are found throughout the body and brain. The receptor for oxytocin is known as OXT. This receptor belongs to the G-protein coupled receptor family of receptors. Oxytocin was first isolated from sheep serum in 1906 by Henry Dale and Charles Robert Harington. It was later synthesized in 1953 by Vincent du Vigneaud. This product has disulfide bonds between Cys1-Cys6.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.2 g/molTyrosyl-Bradykinin
CAS :<p>Tyrosyl-Bradykinin is a peptide that is used as a research tool. It can activate an antibody or receptor and is used in the study of protein interactions. Tyrosyl-Bradykinin has been shown to be an inhibitor of ion channels and can block the activity of ligands and receptors. This peptide has also shown pharmacological properties, such as preventing platelet aggregation and inhibiting the release of histamine from mast cells.</p>Formule :C59H82N16O13Degré de pureté :Min. 95%Masse moléculaire :1,223.4 g/molForchlorofenuron
CAS :<p>Forchlorofenuron is a potent anticancer agent that targets protein kinases in cancer cells, inducing apoptosis and inhibiting tumor growth. This analog of the natural cytokinin hormone has been shown to be effective against a variety of human cancers, including breast, lung, and colon cancer. Forchlorofenuron acts as an inhibitor of protein kinases, which are enzymes that play a key role in cell signaling pathways. By blocking these pathways, Forchlorofenuron can induce apoptosis and prevent the growth and spread of cancer cells. This medicinal compound has been used as a tumor inhibitor in Chinese medicine for many years and can be found in urine samples after administration. Its efficacy against various kinases makes it a promising candidate for future anticancer therapies.</p>Formule :C12H10ClN3ODegré de pureté :Min. 95%Masse moléculaire :247.68 g/mol[D-Arg1,D-Trp7,9,Leu11]-Substance P
CAS :<p>This product is a Substance P antagonist in the Hydrochloride salt from and as a 0.5mg vial. Substance P is a neuropeptide that acts as a neurotransmitter and neuromodulator. It is best known for its role in nociception or pain perception. Substance P is also involved in other biological processes such as the regulation of gastrointestinal motility and the inflammatory response. As a tachykinin neuropeptide, substance P acts through binding to its specific neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is also involved in: increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.</p>Formule :C75H108N20O13Degré de pureté :Min. 95%Masse moléculaire :1,497.8 g/molANP (Human, 5-27)
CAS :<p>ANP (Human, 5-27) is a native peptide amino acid sequence that is found in the human body. It is also known as Atrial Natriuretic Peptide and is a ligand for the ANP receptor. ANP (Human, 5-27) has been shown to activate the receptor by binding with it and thus stimulate the production of cyclic guanosine monophosphate. This substance has been used as a research tool for pharmacology and cell biology studies because of its potential to inhibit or stimulate protein synthesis, depending on its concentration. It has also been used to produce antibodies against it.</p>Formule :C97H154N34O32S3Degré de pureté :Min. 95%Masse moléculaire :2,404.7 g/molLeu-Gly-Gly
CAS :<p>Leu-Gly-Gly is a cyclic peptide that binds to fibrinogen and forms stable complexes with the enzyme form of human serum albumin. It is used as a model system for studying the structure of proteins, and has been shown to bind calcium ions. Leu-Gly-Gly is also an amide and can form stable complexes with basic proteins such as fibrinogen. This peptide also has significant cytotoxicity against polymorphonuclear leucocytes, which may be due to its ability to inhibit polymerase chain activity.</p>Formule :C10H19N3O4Degré de pureté :Min. 95%Masse moléculaire :245.28 g/molCortistatin-8
CAS :<p>Cortistatin-8 is a peptide with the CAS number 485803-62-1. It inhibits the interaction of proteins with other proteins and has an affinity for receptors on cells. Cortistatin-8 is used as a research tool in cell biology, pharmacology, and protein interactions. This peptide may be used to identify new receptors or to study ion channels in living cells. Cortistatin-8 is also being investigated as an inhibitor for drug addiction and obesity.</p>Formule :C47H68N12O9S2Degré de pureté :Min. 95%Masse moléculaire :1,009.3 g/molRociletinib
CAS :<p>Inhibitor of EGFR and T790M-mutated EGFR</p>Formule :C27H28F3N7O3Degré de pureté :Min. 95%Masse moléculaire :555.55 g/molFibronectin Active Fragment (GRGDS)
CAS :<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>Formule :C17H30N8O9Degré de pureté :Min. 95%Masse moléculaire :490.47 g/molLys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Asn-Sta-Val-Ala-Glu-Phe
CAS :<p>Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Asn-Sta-Val-Ala-Glu-Phe is a peptide that inhibits the interaction between the beta2 adrenergic receptor and its ligand. It is a high purity, nonpeptide inhibitor of the beta2 adrenergic receptor that is useful for research purposes. The antibody to Lys-Thr-Glu-Glu-Ile-Ser-Glu Val Asn Sta Val Ala Glu Phe can be used to identify this peptide in Western blot or ELISA experiments.</p>Formule :C73H118N16O27Degré de pureté :Min. 95%Masse moléculaire :1,651.8 g/molN-[1-(Dimethylamino)propan-2-yl]-2-(pyridin-4-yl)-1H-1,3-benzodiazole-4-carboxamide
CAS :<p>N-[1-(Dimethylamino)propan-2-yl]-2-(pyridin-4-yl)-1H-1,3-benzodiazole-4-carboxamide is a molecule that belongs to the class of oxazolidinones. It inhibits matrix metalloproteinases (MMPs) and is used in assays to study the effects of MMPs on cell nuclei, human macrophages, and cellular responses in vitro. In addition, it has shown activity against viruses such as herpes simplex virus and cytosolic cancer cell lines. N-[1-(Dimethylamino)propan-2-yl]-2-(pyridin-4-yl)-1H-1,3-benzodiazole-4-carboxamide also suppresses autoimmune diseases by inhibiting serine proteases. The molecule's effect on cAMP levels has been shown to regulate gene expression at</p>Formule :C18H21N5ODegré de pureté :Min. 95%Masse moléculaire :323.39 g/molBoc-Phe-Ser-Arg-AMC
CAS :<p>Boc-Phe-Ser-Arg-AMC is a peptide that can be used as a research tool in the study of protein interactions, receptor activation and ligand binding. It is an inhibitor of ion channels and has been shown to be an antagonist of nicotinic acetylcholine receptors. This product may be used as a research tool for studying cell biology, pharmacology, and life sciences.</p>Formule :C33H43N7O8Degré de pureté :Min. 95%Masse moléculaire :665.74 g/molNocistatin (Human)
CAS :<p>Nocistatin is a peptide that inhibits the activity of various types of ion channels. It does this by binding to their ligand-binding domain and preventing activation. Nocistatin is used as a research tool in pharmacology, cell biology, and biochemistry to study protein interactions and receptor function. Nocistatin has been shown to be an activator for the L-type calcium channel, suggesting that it may be useful for the treatment of conditions such as epilepsy or cardiac arrhythmias. Nocistatin was originally isolated from the venom of the tarantula Phoneutria nigriventer. It is purified from fish, bovine, or human sources.</p>Formule :C149H238N42O53S3Degré de pureté :Min. 95%Masse moléculaire :3,561.9 g/molBoc-Gln-Arg-Arg-AMC
CAS :<p>Boc-Gln-Arg-Arg-AMC is a Research Tool that is used to study the interactions of protein ligands with receptor and ion channels. It has been shown to inhibit the activity of ion channels, such as calcium and potassium channels.</p>Formule :C32H49N11O8Degré de pureté :Min. 95%Masse moléculaire :715.8 g/molAc-Tyr-NH2
CAS :<p>Ac-Tyr-NH2 is a rotameric peptide that has been shown to inhibit the growth of bacteria. It is a neutral compound and does not have any detectable effect on human serum. Ac-Tyr-NH2 has been shown to react with tryptophan, which may be due to its acid hydrolysis. This peptide also has an active role in the production of reaction products and the formation of model proteins. Ac-Tyr-NH2 has been shown to have an optical property of fluorescence, which can be used for skin reactions or uv absorption.</p>Formule :C11H14N2O3Degré de pureté :Min. 95%Masse moléculaire :222.24 g/molVIP (Human, Porcine)
CAS :<p>VIP is a polypeptide that belongs to the vasoactive intestinal peptide family. VIP is a potent stimulator of adenylate cyclase, which increases intracellular cAMP levels and activates protein kinase A. VIP has been shown to interact with ion channel receptors, such as the nicotinic acetylcholine receptor, and regulate membrane potentials in neuronal cells. It also functions as a ligand for G protein-coupled receptors and can be used as an immunogen or antibody against VIP. VIP has been shown to have a variety of pharmacological effects including the ability to stimulate cell proliferation and inhibit apoptosis. VIP has also been shown to function as an activator of latent TGF-β1, which may play a role in tumor suppression.</p>Formule :C147H238N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,325.8 g/molAc-Tyr-Val-Lys-Asp-H (aldehyde)
CAS :<p>Ac-Tyr-Val-Lys-Asp-H (aldehyde) is a peptide that is used as a research tool in cell biology and pharmacology. Ac-Tyr-Val-Lys-Asp-H (aldehyde) is an inhibitor of the ion channels TRPV1 and TRPA1, which are involved in pain perception. Ac-Tyr-Val-Lys-Asp-H (aldehyde) also binds to the receptor for bradykinin, which is involved in inflammatory reactions. Ac-Tyr-Val-Lys-Asp-H (aldehyde) has been shown to inhibit protein interactions with the receptors for acetylcholine, serotonin, histamine, dopamine, and other neurotransmitters. The CAS number for this compound is 178603–78–6</p>Formule :C26H39N5O8Degré de pureté :Min. 95%PD 0332991 hydrochloride
CAS :<p>Inhibitor of cyclin D kinases Cdk4 and Cdk6; antineoplastic</p>Formule :C24H29N7O2·HClDegré de pureté :Min. 95%Masse moléculaire :483.99 g/molNifeviroc
CAS :<p>Nifeviroc is a peptide that belongs to the class of activators. It is used as a research tool to study the function of ion channels and ligands. Nifeviroc binds to the N-terminal domain of the sodium channel, which activates the channel by increasing its permeability to sodium ions. This leads to an increase in membrane potential, depolarization of the cell, and an increase in neuronal excitability. Nifeviroc has been shown to be effective in blocking pain transmission by inhibiting voltage-gated sodium channels (VGSC).</p>Formule :C33H42N4O6Degré de pureté :Min. 95%Masse moléculaire :590.7 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Mannopyranosyl Fluoride
CAS :<p>2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is a fluorinated glycoside that is used as a reagent in organic synthesis to fluorinate alcohols and amines. It selectively reacts with primary and secondary alcohols to give the corresponding fluorides. The product can be used for the synthesis of carboxylic acids and esters. 2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is also used in biochemistry research as a substrate for oligosaccharide synthesis. This product has been shown to react with proteins to form peptides and with DNA to form nucleosides.</p>Formule :C14H19O9FDegré de pureté :Min. 95%Masse moléculaire :350.29 g/mol[D-Pro2,D-Trp7,9]-Substance P
CAS :<p>This product is a Substance P antagonist and is available as a 0.5mg vial. Substance P is a neuropeptide that is involved in the transmission of pain signals and inflammation. It is a member of the tachykinin neuropeptide family and is produced in the central nervous system and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.</p>Formule :C74H106N20O13SDegré de pureté :Min. 95%Masse moléculaire :1,515.8 g/mol12-(Phenyl(pyridin-2-yl)amino)dodecanoic acid
CAS :<p>12-(Phenyl(pyridin-2-yl)amino)dodecanoic acid is a fatty acid that has been shown to have hypoglycemic effects in diabetic mice. It activates the insulin receptor and increases the sensitivity to insulin, which improves the function of cells in fat tissue and reduces inflammation. In addition, 12-(phenyl(pyridin-2-yl)amino)dodecanoic acid has been shown to have anti-inflammatory properties and may be effective for the treatment of metabolic disorders. This compound also has antioxidant properties and can be used as a natural pigment.</p>Formule :C23H32N2O2Degré de pureté :Min. 95%Masse moléculaire :368.5 g/mol[Sar1,Thr8]-Angiotensin II
CAS :<p>Angiotensin II is a peptide that is produced in the body and has a variety of effects. It is an activator of angiotensin receptors, which are found on cells throughout the body. Angiotensin II also binds to ligand binding sites on the surface of cells, which are called receptors. The receptor-ligand complex activates or inhibits ion channels in the cell membrane, which results in changes in cell function.</p>Formule :C44H69N13O11Degré de pureté :Min. 95%Masse moléculaire :956.1 g/molMps1-IN-2
CAS :<p>Mps1-IN-2 is a potent and selective inhibitor of the mitotic kinase Mps1. It binds to the ATP-binding site of Mps1 and inhibits its activity, leading to cell death by apoptosis or necrosis. Mps1-IN-2 has shown anti-tumor activity against cancer cells in vitro and in vivo without any significant side effects, making it an attractive candidate for cancer therapy. The crystal structure of Mps1-IN-2 bound to the kinase domain revealed that it binds to a pocket with high affinity, where ATP binding leads to conformational changes that affect the other domains of the enzyme. This study has also shown that Mps1-IN-2 inhibits spindle formation and cellular proliferation in cancer cells.</p>Formule :C26H36N6O3Degré de pureté :Min. 95%Masse moléculaire :480.6 g/molHuman Albumin antibody
<p>human Albumin antibody was raised in goat using Purified human Albumin as the immunogen.</p>ApoA-II antibody
<p>ApoA II antibody was raised in goat using Human Apolipoprotein AII as the immunogen.</p>Human IgG (Poly-HRP)
<p>Mouse anti-human IgG (Poly-HRP) was raised in mouse using human IgG as the immunogen.</p>Degré de pureté :Min. 95%Dodecylurea
CAS :<p>Dodecylurea is an activator that binds to a receptor. This ligand-receptor interaction leads to changes in the cell biology, such as ion channels and protein interactions. Dodecylurea is used as a research tool for studying the properties of cells and proteins. It has been shown to inhibit the activity of ion channels, which may be useful in the treatment of pain or epilepsy. Dodecylurea also has pharmacological effects on peptides and proteins, which can be used for research on protein interactions or for therapeutic purposes.</p>Formule :C13H28N2ODegré de pureté :Min. 95%Masse moléculaire :228.37 g/molGN 44028
CAS :<p>GN 44028 is a synthetic small molecule, which is an ATP-competitive inhibitor developed through advanced medicinal chemistry techniques. It specifically targets serine/threonine kinases, a class of enzymes pivotal in cellular signaling and regulation. The inhibitor achieves its effects by binding to the ATP-binding site of these kinases, thereby blocking substrate phosphorylation and downstream signal transduction pathways.</p>Formule :C18N15N3O2Degré de pureté :Min. 95%Masse moléculaire :305.33 g/molSialylglycopeptide
CAS :<p>Sialylglycopeptide is an oligosaccharide that is present in the cell membrane of human erythrocytes. It has been shown to be a ligand for toll-like receptor 2, which is a pattern recognition receptor (PRR) that recognizes pathogen-associated molecular patterns. This molecule is also involved in the inflammatory response and in some infectious diseases. Sialylglycopeptide reacts with nitrite ions to form nitrosogalactopyranoside, which can lead to oxidative injury of cells such as those from the heart or lung. The sialylglycopeptides are also important for lactation, and their levels increase when pregnant women are exposed to glucocorticoids.</p>Formule :C112H189N15O7Degré de pureté :Min. 95%Masse moléculaire :2,865.8 g/molCD24 antibody (biotin)
<p>CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.</p>Degré de pureté :Min. 95%[Nle8,18,Tyr34]-Parathyroid Hormone (Human, 1-34 amide)
<p>Parathyroid hormone (PTH) is a peptide hormone that regulates the concentration of calcium, phosphorus and vitamin D in the blood. It is synthesized by the parathyroid glands and acts on bone, kidney and intestine to regulate the level of these substances in the blood. PTH has an N-terminal 34 amino acid residue that is responsible for the biological activity of the hormone. Inhibitors of PTH are used as research tools to study receptor interactions and ion channels.</p>Formule :C183H296N56O51Degré de pureté :Min. 95%Masse moléculaire :4,096.7 g/molUrocortin (Rat)
CAS :<p>Urocortin is a peptide that is also known as corticotropin-releasing factor (CRF). It is an inhibitor of the protein phosphatase 1 and protein phosphatase 2A, which are enzymes that regulate the activity of other proteins. Urocortin also has the ability to bind to receptors for glucocorticoid hormones, such as GRP and MR, in a manner that activates them. This peptide is used in research studies to study ion channels, neuronal excitability, and other aspects of cell biology. Urocortin has been shown to be a high purity reagent with no detectable impurities.</p>Formule :C206H338N62O64Degré de pureté :Min. 95%Masse moléculaire :4,707.3 g/molBoc-Gly-OH
CAS :<p>Boc-Gly-OH is a cyclic peptide with a fatty acid acyl chain. It is synthesized by reacting the amino acid glycine with sodium carbonate in the presence of trifluoroacetic acid to form the intermediate Boc-Gly-OSu. The product is then reacted with allyl bromide in a second step to produce Boc-Gly-OCH2CH2Br and then reacted with calcium chloride to yield the final product. Boc-Gly-OH has been used as an HIV inhibitor, which may be due to its ability to bind to both CD4 and gp120 proteins on the surface of HIV. This binding inhibits viral entry into host cells by blocking protease activity and fusion of viral envelope with host cell membrane, leading to inhibition of HIV infection.</p>Formule :C7H13NO4Degré de pureté :Min. 95%Masse moléculaire :175.18 g/molPentosidine
CAS :<p>A Pentosidine product which can be used as a biomarker for Advanced Glycation End Products (known as AGEs) and for Glycation-Oxidative stress which is seen in diabetes mellitus type 2. It is available in the Trifluoroacetate Salt form and as a 0.1mg vial.</p>Formule :C17H26N6O4Degré de pureté :Min. 95%Masse moléculaire :378.43 g/molN-(4-Cyanophenyl)-3-hydroxy-2-naphthamide
CAS :<p>N-(4-Cyanophenyl)-3-hydroxy-2-naphthamide is a Research Tool that is used in Cell Biology, Antibody, Ion channels, High purity, Protein interactions and Pharmacology. It has been shown to be an inhibitor of the receptor for the neurotransmitter substance P. This product has no detectable impurities and it is supplied as a white powder.</p>Formule :C18H12N2O2Degré de pureté :Min. 95%Masse moléculaire :288.3 g/molAc-Val-Glu-Ile-Asp-H (aldehyde)
CAS :<p>Ac-Val-Glu-Ile-Asp-H (aldehyde) is a synthetic peptide that is used as an inhibitor to study the effects of protein interactions. Ac-Val-Glu-Ile-Asp-H (aldehyde) binds to the active site of the enzyme, which prevents the enzyme from functioning and can be used as a research tool. Ac-Val-Glu-Ile-Asp-H (aldehyde) has been shown to activate some receptors and ligands, such as ion channels and antibodies.</p>Formule :C22H36N4O9Degré de pureté :Min. 95%Masse moléculaire :500.54 g/molBurixafor hydrobromide
CAS :<p>Burixafor hydrobromide is an anti-tumor agent that belongs to the class of antagonists. It is a potent and selective antagonist of the erythropoietin receptor (EPOR). This drug has been shown to have systemic activity in cancer models by inhibiting tumor growth. Burixafor hydrobromide inhibits tumor cell proliferation by blocking EPOR signaling, which is important for normal red blood cell production. This agent also has a high affinity for deuterated compounds and may be used as a tracer or radiotracer for imaging tumors.</p>Formule :C27H60Br3N8O6PDegré de pureté :Min. 95%Masse moléculaire :863.5 g/molNPY (Porcine, Bovine)
CAS :<p>NPY is a peptide that belongs to the family of neuropeptides. It is an endogenous regulator of appetite and energy expenditure in the central nervous system, which has been shown to act as a neurotransmitter and neuromodulator. NPY is also an activator of ion channels, such as potassium channels, sodium channels, and calcium channels. NPY has been shown to bind with high affinity to receptors in the brain, heart, lungs, kidneys, and intestines. The binding of NPY to its receptor leads to activation of protein interactions. This process can lead to changes in cell physiology or regulation of physiological functions by altering gene expression or changing the concentration of ions in the blood. NPY has also been shown as an inhibitor for many different ligands and receptors including dopamine D1 receptors and serotonin 5-HT2A/C receptors.</p>Formule :C190H287N55O57Degré de pureté :Min. 95%Masse moléculaire :4,253.6 g/molGW-870086
CAS :<p>GW-870086 is a synthetic small molecule compound classified as a selective glucocorticoid receptor agonist. It is derived from structured pharmaceutical research aimed at developing targeted therapies with minimal systemic side effects. This compound selectively binds to glucocorticoid receptors, modulating the transcription of glucocorticoid-responsive genes while attenuating inflammation and immune responses.</p>Formule :C31H39F2NO6Degré de pureté :Min. 95%Masse moléculaire :559.65 g/molCD11b antibody (Azide Free)
<p>CD11b antibody (Azide Free) was raised in rat using C57BL/10 murine splenic T cells and concanavalin A-activated C57BL/10 splenocytes as the immunogen.</p>Degré de pureté :Min. 95%M40
CAS :<p>M40 is a potent antagonist of the muscarinic M1 receptor. It is highly bactericidal, and has been used as a corrosion inhibitor in industrial processes. M40 has been shown to be effective against pancreatitis, as well as other diseases that are related to the muscarinic M1 receptor. M40 has also been used in animals for studies on the effects of thermal expansion and corrosion in living tissues. The chlorine atom in this molecule is responsible for its potent antibacterial activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). This drug can also be synthesized with an amide linkage to linear regression analysis or translation.</p>Formule :C94H145N23O24Degré de pureté :Min. 95%Masse moléculaire :1,981.3 g/molBVT.948
CAS :<p>BVT.948 is a pharmaceutical drug that belongs to the class of specific agonists. It is used in the diagnosis and treatment of chronic lymphocytic leukemia. BVT.948 has vasodilatory effects and can inhibit insulin sensitivity, which may be due to its ability to inhibit the regulatory domain of growth factor receptors. This drug also inhibits phosphatase activity and has been shown to increase insulin sensitivity by suppressing phosphatase activity. BVT.948 has been shown to inhibit the production of inflammatory cytokines, such as IL-6 and IL-8, in response to activation of toll-like receptor 4 (TLR4).</p>Formule :C14H11NO3Degré de pureté :Min. 95%Masse moléculaire :241.24 g/molWAY 316606
CAS :<p>WAY 316606 is a potent, orally administered small molecule that inhibits the Wnt signaling pathway by blocking the action of β-catenin. It has been shown to have potential for treating eye disorders, including age-related macular degeneration. This drug also has potential for treatment of cell and nervous system diseases such as Alzheimer's disease and Huntington's disease. WAY 316606 inhibits the transcriptional activity of the β-catenin/Tcf4 complex by binding to it and preventing its translocation into the nucleus. In addition, WAY 316606 prevents downstream activation of genes regulated by β-catenin signaling, including c-myc and cyclin D1. This drug also blocks growth factor receptor tyrosine kinases and monoclonal antibodies that activate these receptors.</p>Formule :C18H19F3N2O4S2Degré de pureté :Min. 95%Masse moléculaire :448.48 g/mol

