Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.563 produits)
- Par Biological Target(101.038 produits)
- Par usage/effets pharmacologiques(6.954 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.368 produits)
130636 produits trouvés pour "Produits biochimiques et réactifs"
CALCR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CALCR antibody, catalog no. 70R-9835
Degré de pureté :Min. 95%Universal TT epitope P2 (830- 844)
Custom research peptide; min purity 95%.
Formule :C80H129N19O23Degré de pureté :Min. 95%Masse moléculaire :11,725.03 g/molCYC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYC1 antibody, catalog no. 70R-2516
Degré de pureté :Min. 95%PSMA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMA4 antibody, catalog no. 70R-4317
Degré de pureté :Min. 95%CDC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC2 antibody, catalog no. 70R-5615
Degré de pureté :Min. 95%HAPLN2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAPLN2 antibody, catalog no. 70R-9514
Degré de pureté :Min. 95%TNFSF4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF4 antibody, catalog no. 70R-9667
Degré de pureté :Min. 95%TRAPPC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC2 antibody, catalog no. 70R-8937
Degré de pureté :Min. 95%SIRT5 antibody
SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD
GFAP antibody
GFAP antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets glial fibrillary acidic protein (GFAP), which is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody recognizes and binds to GFAP, allowing researchers to study the expression and localization of this protein.
CD24 antibody (Azide Free)
CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.
Fmo3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Fmo3 antibody, catalog no. 70R-8601
Degré de pureté :Min. 95%Mindodilol
CAS :Produit contrôléMindodilol is a research tool that is used in the study of ion channels, receptor-ligand interactions, and cell biology. This compound binds to ion channels, which are responsible for the transmission of ions across the cell membrane, and modulates their activity. Mindodilol also interacts with various receptors and cells during the course of its biological function. It has been shown to inhibit binding of antibodies to proteins as well as peptides.
Formule :C23H28N2O3Degré de pureté :Min. 95%Masse moléculaire :380.50 g/molMan2a2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Man2a2 antibody, catalog no. 70R-8659
Degré de pureté :Min. 95%Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.Degré de pureté :Min. 95%
