Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.560 produits)
- Par Biological Target(101.036 produits)
- Par usage/effets pharmacologiques(6.953 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Ptp inhibitor XVIII
CAS :Ptp inhibitor XVIII is a peptide that has been shown to inhibit the protein tyrosine phosphatase Ptp1. This inhibitor is a competitive and reversible inhibitor of Ptp1 with an IC50 of 1.0 μM. It can be used as a research tool to study the role of Ptp1 in cancer, cell biology, and receptor signaling pathways.
Formule :C19H10BrF6NO3SDegré de pureté :Min. 95%Masse moléculaire :526.25 g/molTMEM117 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM117 antibody, catalog no. 70R-7032
Degré de pureté :Min. 95%K-Ras(G12C) inhibitor 12
CAS :K-Ras(G12C) inhibitor 12 is a histone deacetylase inhibitor that has been shown to sensitize mutant K-Ras-expressing cells to chemotherapeutic drugs. It also has the potential to be used as a diagnostic tool for colon cancer. This compound has been shown to enhance the anti-tumour activity of other cancer medicines, such as 5-fluorocytosine and oxaliplatin, in pancreatic cancer cells.
Formule :C15H17ClIN3O3Degré de pureté :Min. 95%Masse moléculaire :449.67 g/molFamotidine-13C3
CAS :Please enquire for more information about Famotidine-13C3 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H15N7O2S3Degré de pureté :Min. 95%Masse moléculaire :340.4 g/molCitalopram-d6
CAS :Produit contrôléPlease enquire for more information about Citalopram-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C20H21FN2ODegré de pureté :Min. 95%Masse moléculaire :330.4 g/molHNRPK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPK antibody, catalog no. 70R-4651
Degré de pureté :Min. 95%ZDHHC19 antibody
ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
Degré de pureté :Min. 95%Phospho-ginkgolic acid
CAS :Please enquire for more information about Phospho-ginkgolic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C22H37O6PDegré de pureté :Min. 95%Masse moléculaire :428.5 g/molABP 688
CAS :ABP 688 is a radiolabeled ligand, which is a synthetic compound used primarily in positron emission tomography (PET) to visualize metabotropic glutamate receptor subtype 5 (mGluR5) in vivo. Developed from chemical synthesis, ABP 688 acts by selectively binding to the allosteric site of the mGluR5 receptor with high affinity and specificity. When labeled with a positron-emitting isotope such as Carbon-11 or Fluorine-18, it allows for the non-invasive imaging and quantification of mGluR5 distribution and density in the brain.
Formule :C15H16N2ODegré de pureté :Min. 95%Masse moléculaire :240.3 g/molGJD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJD2 antibody, catalog no. 70R-6161
Degré de pureté :Min. 95%RFP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RFP2 antibody, catalog no. 20R-1084
Degré de pureté :Min. 95%SPRR3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPRR3 antibody, catalog no. 70R-3862
Degré de pureté :Min. 95%SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
RAB39 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB39 antibody, catalog no. 70R-4499
Degré de pureté :Min. 95%
