Produits biochimiques et réactifs

Mouse monoclonal GSTT2 antibody

IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV

A synthetic peptide for use as a blocking control in assays to test for specificity of WNT9B antibody, catalog no. 70R-7246

ZNF335 antibody was raised in rabbit using the middle region of ZNF335 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM63 antibody, catalog no. 70R-2552

A synthetic peptide for use as a blocking control in assays to test for specificity of UBD antibody, catalog no. 70R-5744

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINI2 antibody, catalog no. 70R-9424

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B4 antibody, catalog no. 70R-4853

The Enterovirus Antigen is a high-quality product that falls under the category of Proteins and Antigens. It is a fatty acid-based antigen with neutralizing properties. This product is widely used in the field of Life Sciences for research purposes.

Affinity purified Rabbit polyclonal C11orf2 antibody

Region of MDC69 protein corresponding to amino acids GPYGANMEDS VCCRDYVRYR LPLRVVKHFY WTSDSCPRPG VVLLTFRDKE ICADPRVPWV KMILNKLSQ.

A synthetic peptide for use as a blocking control in assays to test for specificity of LRP2BP antibody, catalog no. 70R-3858

The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.

FANCM antibody was raised in Rabbit using Human FANCM as the immunogen

The FRK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets erythropoietin and anti-VEGF, making it an essential tool for studying endothelial growth and antiangiogenic properties. The FRK antibody has been extensively tested and proven to be highly effective in inhibiting the growth factor responsible for angiogenesis. In addition, it has shown cytotoxic effects on cancer cells and has been used to assess microvessel density in tumor samples. This high-quality monoclonal antibody is a valuable asset for researchers and scientists working in the field of antibodies and natriuretic factors. Its colloidal nature ensures easy handling and accurate results, making it an indispensable tool for cutting-edge research in the Life Sciences field.

Hemopressin is a synthetic, orally active, insulin-sensitizing agent. Hemopressin modulates the activity of the insulin receptor by binding to the carboxy terminal domain. This leads to increased insulin sensitivity and glucose uptake in peripheral tissues. Hemopressin has been shown to be effective against experimental models of autoimmune diseases, such as diabetes mellitus type 1 and multiple sclerosis. The drug significantly decreased blood pressure in healthy rats and had no effect on cancer cells or bacterial surface.

MAGE-A1 protein:
MAGE-A1 (278-286) is an epitope of Melanoma Antigen Gene A1 expressed by tumors of different histological types such as on the surface of breast carcinoma cell and is a Cancer/Testis Antigens (CTA). MAGE-A1 is a tumor antigen expressed in 40% of melanoma and contains epitope for binding HLA-A*02:01 molecules and that are recognized by cytotoxic T cells.
Applications of MAGE-A1 (278-286):
MAGE-A1 (278-286) is used to stimulate specific cytotoxic T cells in PBMCs and to analyze by ELISPOT peptide epitope specificity and cytokine production like IFN-γ. Immunogenicity of MAGE-A1 (278-286) raised the possibility of developing anticancer immunotherapies or vaccinations. MAGE-A1 is also expressed in lung adenocarcinoma and studies suggest that MAGE-A1 may serve to develop Chimeric Antigen Receptor (CAR) T cell therapy using lentiviral vector and show an encouraging tumor-inhibitory efficacy.

A synthetic peptide for use as a blocking control in assays to test for specificity of C12orf24 antibody, catalog no. 70R-3636