Produits biochimiques et réactifs

BIBP 3226 is a drug that belongs to the class of beta-blockers. It is a potent and selective beta-adrenergic receptor antagonist that has been shown to have maximal response in the concentration range of 1 nM to 10 micromolar. The effects on blood pressure are dose dependent, with a maximal effect at doses greater than or equal to 0.1 mg/kg. BIBP 3226 has been found to inhibit insulin resistance and increase cardiac contractility in rats, and may also have an inhibitory effect on platelet aggregation. This drug exhibits pharmacokinetic properties that are independent of food intake and is metabolized by CYP3A4 in the liver.

CD44 antibody (Allophycocyanin) was raised in rat using murine CD44 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of COPA antibody, catalog no. 70R-6205

LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL

7-BIA is a potent non-competitive phosphatase inhibitor. It inhibits tyrosine phosphatases by binding to the enzyme's ligand-binding site and preventing substrate from binding. This drug has been shown to inhibit phosphatases in vivo and in vitro studies, including cyclopentyl phosphatase, p38 MAP kinase, and PI3K. 7-BIA also blocks cAMP synthesis and reduces the activity of protein kinase A. 7-BIA is a competitive ligand for the pharmacophore site of the enzyme PP2A, which is found in both brain cells and platelets.

F12 antibody was raised in Rabbit using Human F12 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CPNE9 antibody, catalog no. 70R-4191

A synthetic peptide for use as a blocking control in assays to test for specificity of GAPDHS antibody, catalog no. 70R-3034

Please enquire for more information about Cimlanod including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H2AH antibody, catalog no. 70R-10199

GSK180736A is a potent and selective small-molecule inhibitor of the serine/threonine kinase PKCδ with in vitro IC50 values of 0.5 nM. GSK180736A inhibits the phosphorylation of PKCδ substrates by PKCδ and prevents its nuclear translocation, leading to inhibition of cardiac hypertrophy and insulin resistance. The IC50 value for inhibition of PKCδ activity was determined to be 0.5 nM in an internalization assay using cells expressing GFP-tagged human PKCδ (hPKCδ). In addition, GSK180736A inhibits the phosphorylation of PKCα and ε at a concentration of 1 μM in an in vitro kinase assay. These results suggest that GSK180736A is a selective inhibitor for the kinase domain of PKCδ and other members of the PKC family

Rabbit polyclonal GRIA2/3 antibody

AM 114 is a hydroxyl-containing compound that has been found to have antibacterial activity. The primary target of AM 114 is the informational molecule in bacteria, RNA polymerase. It binds to the catalytic site of RNA polymerase and inhibits bacterial growth. This binding leads to a decrease in bacterial cell size and a decrease in the production of proteins in the bacterial cells. AM 114 also inhibits penicillin-binding protein (PBP) from Staphylococcus aureus, which may be an additional mechanism for its antibacterial effects.

Tyr-Gly-Gly-Phe-Leu-Lys is a synthetic peptide that has been shown to act as an activator of ion channels and as an inhibitor of protein interactions. It is also capable of binding to the receptor, ligand, or pharmacology. Tyr-Gly-Gly-Phe-Leu-Lys has been tested on a variety of cell types including rat primary neurons, CHO cells, COS cells, and human embryonic kidney (HEK) 293 cells. This peptide has shown the ability to inhibit the activity of ion channels such as voltage sensitive sodium channels and calcium channels in rat primary neurons. In CHO cells, Tyr-Gly-Gly-Phe-Leu-Lys was found to inhibit the binding of acetylcholine receptors to their ligands. In HEK 293 cells, this peptide inhibited the binding of dopamine D2 receptors with their ligands.

VU 0285683 is a polyamine analogue that has been shown to have the same effects on mammalian cells as naturally occurring polyamines. By binding to polyamine receptors, VU 0285683 inhibits protein synthesis and induces apoptosis in cultured cells. It has also been shown to inhibit cell proliferation in tissues and organs of mammals.

The CCL5 antibody is a highly specialized polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the CCL5 protein, a growth factor involved in angiogenesis and inflammation. This antibody can be used in various experimental techniques, such as immunohistochemistry or Western blotting, to study the role of CCL5 in different biological processes. It has been extensively tested and validated for its specificity and effectiveness in binding to the target molecule. Researchers can rely on this high-quality antibody to accurately detect and quantify CCL5 levels in samples, providing valuable insights into its function and potential therapeutic applications.

STX1A antibody was raised in rabbit using the N terminal of STX1A as the immunogen

Affinity purified Rabbit polyclonal GEM antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ACO1 antibody, catalog no. 70R-4994

A synthetic peptide for use as a blocking control in assays to test for specificity of Antxr2 antibody, catalog no. 70R-8864