Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12457 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
3-[1-(2-Methoxyethyl)-1H-indol-3-yl]propanoic acid
CAS :Produit contrôléPlease enquire for more information about 3-[1-(2-Methoxyethyl)-1H-indol-3-yl]propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H17NO3Degré de pureté :Min. 95%Masse moléculaire :247.29 g/molZoledronic acid trihydrate
CAS :Farnesyl pyrophosphate synthase inhibitor; hepatic de novo lipogenesis inhibitor
Formule :C5H16N2O10P2Degré de pureté :Min. 95%Masse moléculaire :326.14 g/molrac 5-Hydroxy valproic acid sodium
CAS :Please enquire for more information about rac 5-Hydroxy valproic acid sodium including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H16O3•NaDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :183.2 g/mol3,4,5-Triacetoxybenzoic acid
CAS :Trifluoroacetic acid is an organic acid that is used in the synthesis of esters, ethers, and amides. It can be used to produce 3,4,5-triacetoxybenzoic acid (TABA), which inhibits the proliferation of leukemia cells. TABA binds to the active site of the protein runx2, which is involved in development and differentiation. It also inhibits vibrational spectra and chemical profiles that are related to cancer cell growth. TABA has been shown to induce autophagy through activation of AMPK signaling pathways in leukemia cells. TABA also inhibits lipid accumulation by inhibiting the expression of genes such as SREBP1c and ACC2.
Formule :C13H12O8Degré de pureté :Min. 97 Area-%Couleur et forme :PowderMasse moléculaire :296.23 g/molPyrimidine-5-carboxylic acid
CAS :Pyrimidine-5-carboxylic acid is a synthetic, nucleophilic pyrimidine compound that is used in the laboratory for the synthesis of other compounds. It has been shown to inhibit the growth of Leishmania and Staphylococcus bacteria. Pyrimidine-5-carboxylic acid binds to the malonic acid moiety of phosphoenolpyruvate carboxykinase and inhibits its activity, leading to a reduction in cellular respiration. This drug also has clinical development potential as an analgesic with modulating properties.Formule :C5H4N2O2Degré de pureté :Min. 95%Masse moléculaire :124.1 g/molEthyl 2-chloro-2,2-difluoroacetate
CAS :Ethyl 2-chloro-2,2-difluoroacetate is an organic compound that is used in the synthesis of benzofuran derivatives. It reacts with chlorine to generate a reactive intermediate and then undergoes a nucleophilic substitution reaction to produce the desired compound. The kinetic studies of this reaction have been conducted using isolated yields of the reactants. The active methylene group can undergo a variety of reactions because it has a reactive chlorine atom attached to it. This active substance inhibits the NS5B polymerase, which is responsible for converting RNA into DNA. Ethyl 2-chloro-2,2-difluoroacetate may be used as a potential treatment for inflammatory diseases such as asthma and arthritis because it prevents acetylcholine from binding to its receptor α.
Formule :C4H5ClF2O2Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :158.53 g/mol(1R,2R)-Boc-aminocyclopentane carboxylic acid
CAS :(1R,2R)-Boc-aminocyclopentane carboxylic acid (BCPC) is a high quality, reagent, and useful intermediate. It is a versatile building block that can be used as a speciality chemical or research chemical. BCPC has been shown to react with amines to form ureas, with nitriles to form oxazolidines, and with epoxides to form aziridinones.Formule :C11H19NO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :229.27 g/molMagnesium acetate tetrahydrate
CAS :Magnesium acetate tetrahydrate is a white crystalline solid that is soluble in water and is used as a nutritional supplement. It is produced by the reaction of magnesium carbonate with an aqueous solution of acetic acid. The particle size varies depending on the synthesis method used. Magnesium acetate tetrahydrate has been shown to be effective for treating diabetes mellitus, as it helps regulate blood sugar levels by promoting insulin release from pancreatic cells and increasing glucose uptake into these cells. This compound also has been found to be effective in reducing hiv infection rates, which may be due to its ability to increase the activity of CD4+ T-cells.Formule :Mg(C2H3O2)2•(H2O)4Degré de pureté :Min. 95%Couleur et forme :White/Off-White SolidMasse moléculaire :214.45 g/molTrichloroacetic anhydride
CAS :Trichloroacetic anhydride is a chemical compound that is used in organic synthesis. It is a strong acid that reacts with fatty acids to form trifluoroacetic acid, which can be used as an analytical method for determining the presence of amines in a sample. It also shows inhibitory properties against inflammatory bowel disease and has been shown to have anti-inflammatory activity. Trichloroacetic anhydride is not very soluble in water, but it can be dissolved in alcohols and alkalis. This compound's ability to react with hydroxyl groups makes it useful for the synthesis of esters and ethers. Trichloroacetic anhydride's ability to react with intramolecular hydrogen may lead to metabolic disorders such as diabetes mellitus.
Formule :C4Cl6O3Degré de pureté :Min. 95%Masse moléculaire :308.76 g/mol(S)-2-Hydroxy-3-methoxy-3,3-diphenylpropionic acid
CAS :This is a crystalline form of the pyrimidine derivative (S)-2-Hydroxy-3-methoxy-3,3-diphenylpropionic acid. The compound has been shown to have antiplatelet properties and is currently being developed as an antithrombotic agent. In vitro studies have shown that ambrisentan inhibits platelet aggregation, thromboxane synthesis, and leukocyte adhesion. It also reduces the levels of serum cholesterol and triglycerides in patients with chronic heart failure. Ambrisentan has been studied in clinical trials for the treatment of pulmonary hypertension associated with chronic obstructive pulmonary disease (COPD) and idiopathic pulmonary fibrosis (IPF).Formule :C16H16O4Degré de pureté :Min. 95%Masse moléculaire :272.3 g/mol1-Phenyl-1H-pyrrole-2-carboxylic acid
CAS :1-Phenyl-1H-pyrrole-2-carboxylic acid is a heterocyclic compound with a carbonyl group. It is the simplest furan derivative. 1PPC has been shown to react with phosphite and trimethyl phosphite to form an intramolecular cycloaddition product, which is a biomolecular reaction. 1PPC competes with furan for the formation of pyrroles. This study also showed that pyrrole rings can be opened by 1PPC and other carbonyl groups in the presence of base, forming new compounds.Formule :C11H9NO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :187.19 g/molChlormadinol acetate
CAS :Produit contrôléChlormadinol acetate is a stable complex of a fatty acid and an antibiotic that is used to treat infections caused by bacteria. It has been shown to have high resistance to antimicrobial agents, including amoxicillin-clavulanic acid, tetracycline, and multidrug efflux pumps. Chlormadinol acetate has also been shown to inhibit the growth of certain cancer cells in vitro and in vivo using gene therapy. This drug also inhibits bacterial protein synthesis by binding to the 30S ribosomal subunit and preventing the formation of a functional 70S ribosome. Chlormadinol acetate has been shown to be clinically relevant in mice when used with amoxicillin-clavulanic acid or tetracycline.Formule :C23H31ClO4Degré de pureté :Min. 95%Masse moléculaire :406.94 g/mol1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid
CAS :Produit contrôléPlease enquire for more information about 1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C17H18N2O2Degré de pureté :Min. 95%Masse moléculaire :282.34 g/molL-Azetidine-2-carboxylic acid
CAS :L-Azetidine-2-carboxylic acid is a natural product that has been shown to have anticancer effects. It has been shown to induce apoptosis in cancer cells by binding to response elements on the DNA, which causes DNA damage and cell death. L-Azetidine-2-carboxylic acid also inhibits protein synthesis by interfering with the uptake of amino acids, which are essential for protein production. This compound is not toxic to healthy cells because it cannot cross the lipid bilayer of the cell membrane. L-Azetidine-2-carboxylic acid also induces autophagy in cancer cells, causing them to destroy their own cellular components. There is evidence that this compound may be effective for other diseases such as diabetes and neurodegenerative disorders due to its ability to regulate intracellular calcium levels and its cytosolic function as a substrate molecule.Formule :C4H7NO2Degré de pureté :Min. 95%Couleur et forme :White To Light (Or Pale) Yellow SolidMasse moléculaire :101.1 g/mol3-(2,5-Dioxoimidazolidin-4-yl)propanoic acid
CAS :3-(2,5-Dioxoimidazolidin-4-yl)propanoic acid (3DAP) is a histidine analog that belongs to the group of fatty acid derivatives. It has been shown to be effective in the diagnosis of obesity and provides a new approach for the treatment of obesity. 3DAP binds to organic anion transporters, which are proteins that transport organic anions across cell membranes. This binding inhibits the transport of organic anion substrates and leads to increased concentrations of these substrates in blood plasma. 3DAP is a competitive inhibitor against estrone sulfate, which is one of its major metabolites. 3DAP has shown efficacy in animal models for obesity, diabetes, and hepatic steatosis.Formule :C6H8N2O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :172.14 g/mol3-Amino-5-methoxybenzoic acid
CAS :3-Amino-5-methoxybenzoic acid is a macrocyclist, which means that it can switch between two different forms. When the temperature is below 27 degrees Celsius, it exists as a mesomorphic phase and when the temperature increases above 27 degrees Celsius, it exists as an isotropic phase. 3-Amino-5-methoxybenzoic acid also has homologues that are also mesomorphic or isotropic depending on their temperatures. The chemoenzymatic parameters of the two phases are different and so are their lamellar morphologies. The fluorine atom in 3-amino-5-methoxybenzoic acid makes it act like a Lewis acid, decreasing its melting point and increasing its vapor pressure. There are two isomers of 3-amino-5-methoxybenzoic acid: dodecyl and octadecyl 3--amino--5--methoxybenFormule :C8H9NO3Degré de pureté :Min. 95%Couleur et forme :White To Yellow To Light Brown SolidMasse moléculaire :167.16 g/mol1-BOC-2,3-Dihydropyrrole-4-boronic acid, pinacol ester
CAS :Please enquire for more information about 1-BOC-2,3-Dihydropyrrole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H26BNO4Degré de pureté :Min. 95%Masse moléculaire :295.18 g/molBetamethasone 21-acetate-17-propionate
CAS :Produit contrôléBetamethasone 21-acetate-17-propionate is a drug product that is a mixture of betamethasone and betamethasone dipropionate. It is used to treat inflammatory skin conditions such as dermatitis, eczema, psoriasis, and other conditions. Betamethasone 21-acetate-17-propionate is one of the most potent corticosteroids available for topical use. The validation process has been completed on the acetonitrile phase and the reversed phase mobile phase. The validation was successful for both the acetonitrile and reversed phases. A validated HPLC method was developed for this drug product in order to monitor its production process.Formule :C27H35FO7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :490.56 g/mol2-Methoxy-4-amino-5-ethylthiobenzoic acid
CAS :Please enquire for more information about 2-Methoxy-4-amino-5-ethylthiobenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C10H13NO3SDegré de pureté :Min. 95%Masse moléculaire :227.28 g/molKisspeptin-54 (human) trifluoroacetate salt
CAS :Kisspeptin-54 is a mammalian peptide hormone that regulates the release of gonadotropin-releasing hormone (GnRH) from the hypothalamus. Kisspeptin-54 has been shown to be potently immunogenic in humans and can be used as an antigen for the production of monoclonal antibodies. It is also a candidate drug for the treatment of obesity and may have neuroprotective effects. Kisspeptin-54 has been shown to reduce body mass index, which may be due to its ability to stimulate the immune system and promote antibody production against tumors. This peptide also has potent on-line binding properties that are useful in polymerase chain reactions.Formule :C258H401N79O78Degré de pureté :Min. 95%Masse moléculaire :5,857.43 g/mol3,3-Difluoro-1-methylcyclobutanecarboxylic acid
CAS :Please enquire for more information about 3,3-Difluoro-1-methylcyclobutanecarboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C6H8F2O2Degré de pureté :Min. 95%Masse moléculaire :150.12 g/mol4-(4-Hydroxymethyl-3-methoxyphenoxy)-butyric acid
CAS :Produit contrôlé4-(4-Hydroxymethyl-3-methoxyphenoxy)-butyric acid (HMPA) is a synthetic compound that is used in the production of butyric acid. It is also used as a reagent in the preparation of enzymes and enzyme preparations, such as serine proteases. HMPA has been used as an intermediate in the synthesis of ribulose, which is a sugar molecule found in plants. The structure of this compound can be determined by FTIR spectroscopy and by X-ray crystallography. HMPA has been shown to have hydrogen bonding between its molecules, which may account for its stability. Hydrogen bonding accounts for the solidity of this compound and its resistance to heat and solvents.Formule :C12H16O5Degré de pureté :Min. 95%Masse moléculaire :240.25 g/molEthanesulfonic acid - 70% aqueous solution
CAS :Ethanesulfonic acid is a highly reactive and readily available chemical that has been investigated for the treatment of cancer. It has shown to be effective as an adjuvant in the treatment of bowel disease and radiation therapy. Ethanesulfonic acid is also used as an antimicrobial agent and disinfectant. This chemical can be used to produce polymers with glycol ethers, coumarin derivatives, and dextran sulfate for use in biological samples such as blood or urine. Ethanesulfonic acid is a potent inhibitor of the polymerase chain reaction (PCR). The inhibition of PCR may be due to its ability to inhibit enzyme activities involved in DNA synthesis, including dinucleotide phosphate enzymes and glycol-ether-sensitive enzymes.
Formule :C2H6O3SDegré de pureté :Min. 95%Couleur et forme :Colourless To Pale Yellow Clear LiquidMasse moléculaire :110.13 g/mol4-Diazobenzenesulfonic Acid
CAS :Applications 4-Diazobenzenesulfonic acid (cas# 305-80-6) is a useful research chemical.
Formule :C6H4N2O3SMasse moléculaire :184.17Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt
CAS :Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C92H130N28O37SDegré de pureté :Min. 95%Masse moléculaire :2,252.25 g/molDimercaptosuccinic acid
CAS :Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.Formule :C4H6O4S2Couleur et forme :White PowderMasse moléculaire :182.22 g/molMet-Enkephalin-Arg acetate salt
CAS :Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C33H47N9O8SDegré de pureté :Min. 95%Masse moléculaire :729.85 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS :Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C54H99N15O14SDegré de pureté :Min. 95%Masse moléculaire :1,214.52 g/mol2-Hydroxy-4-(methylthio)butyric acid calcium salt
CAS :2-Hydroxy-4-(methylthio)butyric acid calcium salt (2HMBAC) is a fatty acid that is found in malic acid. It is an important industrial chemical used for the preparation of other chemicals such as acetic anhydride, adipic acid, and butyric acid. 2HMBAC has been shown to have various biological functions including the inhibition of protein synthesis and the reduction of chloride ion transport. The dietary administration of 2HMBAC has been shown to relieve diarrhoea in rats.Formule :C10H18CaO6S2Degré de pureté :Min. 95%Masse moléculaire :338.46 g/molTRH-AMC acetate salt
CAS :TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt is a potent and selective histidine kinase inhibitor that modulates the activity of many enzymes. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has a molecular weight of 476.9 g/mol and chemical formula C12H14N2O4S. The compound was synthesized by reacting tris(2,4,6-trimethoxybenzoyl)amine with pyridoxal 5'-phosphate and histidine in acetic acid. The synthesis reaction yielded a white solid that was then recrystallized from methanol to yield the final product. TRH-AMC acetate salt Pyr-His-Pro-AMC acetate salt has been shown to inhibit the enzymatic activity of numerous enzymes at nanomolar concentrations including: protein kinases, phosphatases, ligasesFormule :C26H28N6O6Degré de pureté :Min. 95%Masse moléculaire :520.54 g/molEthyl 4-bromoacetoacetate
CAS :Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.Formule :C6H9BrO3Degré de pureté :90%NmrMasse moléculaire :209.04 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS :Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C49H82N16O11S3Degré de pureté :Min. 95%Masse moléculaire :1,167.47 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-Lys-OH acetate salt
CAS :Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.Formule :C29H51N11O11Degré de pureté :Min. 95%Masse moléculaire :729.78 g/molBiotinyl-pTH (1-34) (human) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C191H305N57O53S3Degré de pureté :Min. 95%Masse moléculaire :4,344.02 g/molAlpha-Casein (90-96) trifluoroacetate salt
CAS :Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C43H64N10O12Degré de pureté :Min. 95%Masse moléculaire :913.03 g/molFmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid
CAS :Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C24H29NO7SDegré de pureté :Min. 95%Masse moléculaire :475.56 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/molH-Gly-Pro-Pro-OH trifluoroacetate salt
CAS :H-Gly-Pro-Pro-OH trifluoroacetate salt is an amide with a high specificity and low energy. This compound is activated by sequences of collagen, which may be due to its ability to hydrate intracellular calcium concentrations. H-Gly-Pro-Pro-OH trifluoroacetate salt has been shown to have polymerase chain activation activity in the presence of lysine residues, and it can bind to regulatory sites on DNA. H-Gly-Pro-Pro-OH trifluoroacetate salt has also been shown to have hydroxyproline hydroxylase activity, which leads to a helical structure.Formule :C12H19N3O4Degré de pureté :Min. 95%Masse moléculaire :269.3 g/mol5-Ethylpyridine-2-carboxylic acid
CAS :5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridineFormule :C8H9NO2Degré de pureté :Min. 95%Couleur et forme :Off-White PowderMasse moléculaire :151.16 g/mol16-Mercaptohexadecanoic acid
CAS :16-Mercaptohexadecanoic acid (16MHDA) is a fatty acid that has been shown to be an effective inhibitor of the enzyme fatty acid synthase. This enzyme is responsible for the synthesis of long-chain polyunsaturated fatty acids and their derivatives, which are key components of cell membranes and also act as signaling molecules. 16MHDA can be used in the treatment of diseases such as psoriasis, rheumatoid arthritis, and cancer. 16MHDA has been shown to have a high detection sensitivity and activity index when used in electrochemical impedance spectroscopy experiments. The x-ray diffraction data show that 16MHDA forms an acid complex with its substrate, which is thought to be the reaction mechanism. Colloidal gold has been used to study the interaction between 16MHDA and DNA duplexes. This compound was also found to have monoclonal antibody binding properties in human serum samples.
Formule :C16H32O2SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :288.49 g/molPAR-3 (1-6) amide (mouse) trifluoroacetate salt
CAS :Please enquire for more information about PAR-3 (1-6) amide (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C25H36N8O8Degré de pureté :Min. 95%Masse moléculaire :576.6 g/molHexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt
Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C153H250N44O43SDegré de pureté :Min. 95%Masse moléculaire :3,425.96 g/molOrexin A (17-33) trifluoroacetate salt
CAS :Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesisFormule :C79H125N23O22Degré de pureté :Min. 95%Masse moléculaire :1,748.98 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C191H291N53O56SDegré de pureté :Min. 95%Masse moléculaire :4,257.74 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS :Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C78H111N21O16Degré de pureté :Min. 95%Masse moléculaire :1,598.85 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS :The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.Formule :C54H56N6O13Degré de pureté :Min. 95%Masse moléculaire :997.06 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS :Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C38H37F3N8O11Degré de pureté :Min. 95%Masse moléculaire :838.74 g/molIndole-3-acetic-L-alanine
CAS :Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.Formule :C13H14N2O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :246.26 g/molHemokinin 1 (human) trifluoroacetate salt
CAS :Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).Formule :C54H84N14O14SDegré de pureté :Min. 95%Masse moléculaire :1,185.4 g/molH-Phe-Met-D-Arg-Phe-NH2 acetate salt
CAS :Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C29H42N8O4SDegré de pureté :Min. 95%Masse moléculaire :598.76 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS :Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C141H203N41O38Degré de pureté :Min. 95%Masse moléculaire :3,080.37 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate
CAS :Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.
Formule :C109H159N25O32S5•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :2,491.91 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS :PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.Formule :C29H56N10O7Degré de pureté :Min. 95%Masse moléculaire :656.82 g/mol(Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C147H238N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,325.8 g/molH-Ile-Arg-OH acetate salt
CAS :H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.
Formule :C12H25N5O3Degré de pureté :Min. 95%Masse moléculaire :287.36 g/molH-Pro-Phe-Lys-OH acetate salt
CAS :Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C20H30N4O4Degré de pureté :Min. 95%Masse moléculaire :390.48 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C188H282N52O59S2Degré de pureté :Min. 95%Masse moléculaire :4,278.7 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C134H180N34O26S2Degré de pureté :Min. 95%Masse moléculaire :2,747.21 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS :Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C135H222N38O49Degré de pureté :Min. 95%Masse moléculaire :3,161.43 g/mol4-(4-Phenylbutoxy)benzoic acid
CAS :4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.
Formule :C17H18O3Degré de pureté :Min. 95%Masse moléculaire :270.32 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS :Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H77N9O12SDegré de pureté :Min. 95%Masse moléculaire :1,028.27 g/molpTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C197H317N63O53Degré de pureté :Min. 95%Masse moléculaire :4,416.02 g/mol(DL-Isoser 1)-TRAP-6 trifluoroacetate salt
CAS :Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C34H56N10O9Degré de pureté :Min. 95%Masse moléculaire :748.87 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS :Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H14NNaO6SDegré de pureté :Min. 95%Masse moléculaire :323.3 g/mol4-Sulfamylbenzoic acid
CAS :4-Sulfamylbenzoic acid is a model system for the study of transporter and receptor activity. It has been shown to have the ability to inhibit tubule cells in carcinoma cell lines by binding to the protein target, nitrogen atoms, and hydrophobic effect. 4-Sulfamylbenzoic acid has also been shown to bind to the drug transporter and receptor activity. This binding prevents the formation of an inhibitor-transmitter complex with the enzyme that is required for transport or receptor activity, as well as inhibiting protein synthesis and cell division. The kinetic and reaction mechanism are not known at this time.Formule :C7H7NO2SDegré de pureté :Min. 95%Masse moléculaire :169.2 g/mol(Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H295N53O57S2Degré de pureté :Min. 95%Masse moléculaire :4,345.87 g/mol7-Amino-3-vinyl-3-cephem-4-carboxylic acid
CAS :7-Amino-3-vinyl-3-cephem-4-carboxylic acid (AVC) is a synthetic, inorganic acid that is used clinically. It is produced by the hydrolysis of chlorocarboxylic acids and has been shown to be effective as an antihypertensive agent. AVC has also been used as a catalyst for acylation reactions with chlorides and trifluoroacetic acid. This process yields a reaction yield that can be up to 95% with the use of catalysts such as aluminum chloride or zinc chloride. AVC has been shown to be an environmentally safe alternative to hydrogen chloride, which has been linked to environmental pollution.Formule :C9H10N2O3SDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :226.25 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS :Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.Formule :C28H43N9O7Degré de pureté :Min. 95%Masse moléculaire :617.7 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C90H151N29O25Degré de pureté :Min. 95%Masse moléculaire :2,039.34 g/molBeclomethasone 21-acetate 17-propionate
CAS :Produit contrôléPlease enquire for more information about Beclomethasone 21-acetate 17-propionate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C27H35ClO7Degré de pureté :Min. 95%Masse moléculaire :507.02 g/molN-Boc-isonipecotic acid
CAS :N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.Formule :C11H19NO4Degré de pureté :Min. 95%Masse moléculaire :229.27 g/molNeuropeptide Y (2-36) (porcine) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C181H278N54O55Degré de pureté :Min. 95%Masse moléculaire :4,090.47 g/molLQEQ-19 (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about LQEQ-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C106H165N29O34Degré de pureté :Min. 95%Masse moléculaire :2,389.62 g/mol(4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid
CAS :Please enquire for more information about (4-(Methoxycarbonyl)-3-Methylphenyl)boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C9H11BO4Degré de pureté :Min. 95%Masse moléculaire :193.99 g/mol(Ile3)-Pressinoic acid
CAS :Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.Formule :C30H44N8O10S2Degré de pureté :Min. 95%Masse moléculaire :740.85 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS :L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.Formule :C21H42N6O5Degré de pureté :Min. 95%Masse moléculaire :458.6 g/molD-α-Hydroxyisovaleric acid
CAS :D-alpha-Hydroxyisovaleric acid is a compound that is used to synthesize stereoisomers. It is also a component of supramolecular chemistry and has been used in the construction of supramolecular polymers. D-alpha-Hydroxyisovaleric acid can be found in some plants, such as valinomycin, isovaleric acid, and metarhizium. This stereoisomer can be synthetized from the hydroxy group and an amino acid or peptide. D-alpha-Hydroxyisovaleric acid has the ability to degrade nonribosomal peptides into smaller molecules through its hydrolytic properties. It also inhibits Verticillium dahliae, which causes wilt disease in plants, by inhibiting the synthesis of hydroxycarboxylates. D-alpha-Hydroxyisovaleric acid is biodegradable and can be used for industrial purposes as well as pharmaceuticals.Formule :C5H10O3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :118.13 g/molH-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt
CAS :Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C28H49N7O11Degré de pureté :Min. 95%Masse moléculaire :659.73 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS :Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C28H30N4O4S2Degré de pureté :Min. 95%Masse moléculaire :550.69 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS :Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C13H25N7O5Degré de pureté :Min. 95%Masse moléculaire :359.38 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS :H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.Formule :C106H172N32O32Degré de pureté :Min. 95%Masse moléculaire :2,406.7 g/mol3-Piperidin-1-ylpropanoic acid
CAS :3-Piperidin-1-ylpropanoic acid is a hydroxylated compound that belongs to the group of aromatic hydrocarbons. It has been shown to inhibit the activity of enzymes such as model studies and test compounds, which are used in biological samples. 3-Piperidin-1-ylpropanoic acid is not active against mouse tumor cells and does not show any locomotor activity. The terminal half life of this drug has been determined in urine samples from mice at 20 hours.
Formule :C8H15NO2Degré de pureté :Min. 95%Masse moléculaire :157.21 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS :Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C29H42N8O4SDegré de pureté :Min. 95%Masse moléculaire :598.76 g/molBradykinin (2-7) acetate salt
CAS :Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C29H40N6O8Degré de pureté :Min. 95%Masse moléculaire :600.66 g/molH-Val-Lys-OH monoacetate salt
CAS :Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C11H23N3O3•C2H4O2Degré de pureté :Min. 95%Masse moléculaire :305.37 g/molH-Pro-Pro-Gln-OH trifluoroacetate salt
CAS :Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H24N4O5Degré de pureté :Min. 95%Masse moléculaire :340.38 g/mol4,4',4''-Nitrilotribenzoic acid
CAS :4,4',4''-Nitrilotribenzoic acid is a low molecular weight activated compound with a hexane molecule and luminescence properties. This compound has been used in the detection of human pathogens, for example, Salmonella enterica serovar Typhimurium. The uptake of 4,4',4''-nitrilotribenzoic acid by these bacteria has been shown to be due to its peroxidase-like activity. 4,4',4''-Nitrilotribenzoic acid has also been used for the activation of polybenzimidazole and for polymerization reactions in polybenzimidazole films. The time required for polymerization depends on the concentration of 4,4',4''-nitrilotribenzoic acid used.
Formule :C21H15NO6Degré de pureté :Min. 95%Masse moléculaire :377.35 g/molH-Ala-His-Lys-OH acetate salt
CAS :H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.Formule :C15H26N6O4Degré de pureté :Min. 95%Masse moléculaire :354.4 g/mol(D-Trp8)-gamma2-MSH trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C74H99N21O16SDegré de pureté :Min. 95%Masse moléculaire :1,570.78 g/molFITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS :Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C131H191N37O25S2Degré de pureté :Min. 95%Masse moléculaire :2,748.28 g/mol(Tyr9)-beta-MSH (porcine) trifluoroacetate salt
CAS :Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C101H140N24O30SDegré de pureté :Min. 95%Masse moléculaire :2,202.4 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS :Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.Formule :C70H113N25O13SDegré de pureté :Min. 95%Masse moléculaire :1,544.87 g/molAcetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C157H252N44O43SDegré de pureté :Min. 95%Masse moléculaire :3,476.02 g/moltert-Butyl acetate
CAS :tert-Butyl acetate is an organic compound that is used in the synthesis of pharmaceuticals. It is a colorless liquid that can be evaporated to produce a white solid. It has a strong odor and is soluble in water, acetone, and most other organic solvents. Tert-butyl acetate can also be used as a solvent for coatings and adhesives, or as an additive to fuels.
Formule :C6H12O2Degré de pureté :Min. 95%Couleur et forme :Colorless Clear LiquidMasse moléculaire :116.16 g/molEndothelin-2 (human, canine) trifluoroacetate
CAS :Trifluoroacetate saltFormule :C115H160N26O32S4Degré de pureté :Min. 95%Masse moléculaire :2,546.92 g/molLHRH (4-10) acetate salt
CAS :Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C33H53N11O9Degré de pureté :Min. 95%Masse moléculaire :747.84 g/molH-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS :H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.
Formule :C22H37N9O10Degré de pureté :Min. 95%Masse moléculaire :587.58 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS :Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS :Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C42H58N12O16Degré de pureté :Min. 95%Masse moléculaire :986.98 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C135H207N39O30SDegré de pureté :Min. 95%Masse moléculaire :2,888.4 g/mol
![3-[1-(2-Methoxyethyl)-1H-indol-3-yl]propanoic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFM135770.webp&w=3840&q=75)
![1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFI117604.webp&w=3840&q=75)
![6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimeth…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN110943.webp&w=3840&q=75)
