Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12457 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
2,7-Naphthalenedicarboxylicacid
CAS :2,7-Naphthalenedicarboxylic acid is a synthetic compound that belongs to the group of aromatic hydrocarbons. It has been shown to have magnetic resonance spectroscopy (MRS) and X-ray structures that are similar to those of phenyl substituents. 2,7-Naphthalenedicarboxylic acid also shows supramolecular interactions with other molecules. The asymmetry can be explained by the presence of a nitrogen atom in the molecule, which can form intramolecular hydrogen bonds.
Formule :C12H8O4Degré de pureté :Min. 95%Masse moléculaire :216.19 g/molErythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt
CAS :Please enquire for more information about Erythropoietin Mimetic Peptide Sequence 20 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C72H99N17O17S2Degré de pureté :Min. 95%Masse moléculaire :1,538.79 g/moltert-Butyl oxazol-5-ylcarbamate
CAS :Please enquire for more information about tert-Butyl oxazol-5-ylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C8H12N2O3Degré de pureté :Min. 95%Masse moléculaire :184.19 g/mol(Lys4)-Sarafotoxin C acetate salt
CAS :A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.Formule :C105H153N27O36S5Degré de pureté :Min. 95%Masse moléculaire :2,529.83 g/molM65 trifluoroacetate salt
Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C205H326N64O61S5Degré de pureté :Min. 95%Masse moléculaire :4,823.51 g/molProadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS :Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C111H177N37O28Degré de pureté :Min. 95%Masse moléculaire :2,477.83 g/mol5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS :Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C89H138N34O18Degré de pureté :Min. 95%Masse moléculaire :1,972.27 g/mol1,3,6,8-Pyrenetetrasulfonic acid tetrasodium, 10% aqueous solution
CAS :1,3,6,8-Pyrenetetrasulfonic acid tetrasodium salt (PTS) is a palladium complex that is used as a catalyst in the chemical industry. It can be prepared by the reaction of palladium chloride with sodium sulfide and sodium hydroxide. PTS has been shown to react with diethyl succinate, forming a solid catalyst that can be stored for longer periods of time. This compound has been found to catalyze hydrogenations under constant pressure conditions and also exhibit low energy consumption when performing reactions. PTS is able to bind to DNA, leading to cancer cell death. PTS also has fluorescence properties and can be used in electrochemical impedance spectroscopy.Formule :C16H10O12S4•Na4Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :614.47 g/molAPL1b27 trifluoroacetate salt
CAS :Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C103H174N30O38SDegré de pureté :Min. 95%Masse moléculaire :2,472.73 g/molAlpha-Conotoxin MI trifluoroacetate salt
CAS :Produit contrôléA component of Conus venom; antagonist of nicotinic acetylcholine receptorsFormule :C58H88N22O17S4Degré de pureté :Min. 95%Masse moléculaire :1,493.72 g/mol(D-Ala2)-Leu-Enkephalin-Arg acetate salt
CAS :Please enquire for more information about (D-Ala2)-Leu-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C35H51N9O8·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :725.84 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS :Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H37N5O4•3C2H4O2Degré de pureté :Min. 95%Masse moléculaire :567.67 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS :Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H109N23O18SDegré de pureté :Min. 95%Masse moléculaire :1,628.86 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS :H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.Formule :C29H54N8O10Degré de pureté :Min. 95%Masse moléculaire :674.79 g/molMca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS :Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C86H125N27O29Degré de pureté :Min. 95%Masse moléculaire :2,001.08 g/molIntermedin-53 (human) trifluoroacetate salt
Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C247H395N83O73S3Degré de pureté :Min. 95%Masse moléculaire :5,791.49 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS :H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.Formule :C65H93N15O26Degré de pureté :Min. 95%Masse moléculaire :1,500.52 g/molAnti-Kentsin trifluoroacetate salt
CAS :Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H45N11O6Degré de pureté :Min. 95%Masse moléculaire :559.66 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS :Acetate saltFormule :C141H235N47O41·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :3,244.67 g/mol(R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate
CAS :Please enquire for more information about (R)-tert-Butyl 3-formylpyrrolidine-1-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C10H17NO3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :199.25 g/mol1-Methyl-1H-imidazole-5-boronic acid pinacol ester
CAS :Please enquire for more information about 1-Methyl-1H-imidazole-5-boronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C10H17BN2O2Degré de pureté :Min. 95%Masse moléculaire :208.07 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H102N18O26S4Degré de pureté :Min. 95%Masse moléculaire :1,667.86 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H85N19O13Degré de pureté :Min. 95%Masse moléculaire :1,208.37 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS :Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C47H74N10O14SDegré de pureté :Min. 95%Masse moléculaire :1,035.22 g/molDi-tert-butyl azodicarboxylate
CAS :Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalableFormule :C10H18N2O4Degré de pureté :Min. 98%Couleur et forme :PowderMasse moléculaire :230.26 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C116H176N26O30S2Degré de pureté :Min. 95%Masse moléculaire :2,478.93 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS :(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-DFormule :C15H23N5O4Degré de pureté :Min. 95%Masse moléculaire :337.37 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS :2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.Formule :C7H8N2O2·xHClDegré de pureté :(%) Min. 60%Couleur et forme :PowderMasse moléculaire :188.61 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS :Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C63H113N22O25PSDegré de pureté :Min. 95%Masse moléculaire :1,641.74 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C69H85FN16O13Degré de pureté :Min. 95%Masse moléculaire :1,365.51 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS :Intermediate in the synthesis of afatinibFormule :C6H12ClNO2Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :165.62 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS :Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C21H35N7O3Degré de pureté :Min. 95%Masse moléculaire :433.55 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt
CAS :Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C151H228N40O47·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :3,355.67 g/molPhylloseptin-L2 trifluoroacetate salt
CAS :Please enquire for more information about Phylloseptin-L2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C76H126N18O19Degré de pureté :Min. 95%Masse moléculaire :1,595.92 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS :Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H109N19O16Degré de pureté :Min. 95%Masse moléculaire :1,508.77 g/mol3,4,5-Trimethoxybenzoic acid anhydride
CAS :3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).
Formule :C20H22O9Degré de pureté :(%) Min. 85%Couleur et forme :PowderMasse moléculaire :406.38 g/mol2,4-Dinitrophenylacetic acid
CAS :2,4-Dinitrophenylacetic acid is a chemical substance with the potential to inhibit acetylation. It can be used as an antigen and has been detected in environmental chemistry. 2,4-Dinitrophenylacetic acid is produced by the reaction of chemicals that are found in the environment and it can be detected at low concentrations. This compound is able to react with proteins in cells, leading to high cytotoxicity. 2,4-Dinitrophenylacetic acid can also stabilize optical systems.Formule :C8H6N2O6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :226.14 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C51H79N17O13Degré de pureté :Min. 95%Masse moléculaire :1,138.28 g/mol2-Fluoro-6-methylbenzoic acid
CAS :Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H7FO2Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :154.14 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS :Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.Formule :C61H87N17O14Degré de pureté :Min. 95%Masse moléculaire :1,282.45 g/molH-Arg-Phe-Ala-OH acetate salt
CAS :Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H28N6O4Degré de pureté :Min. 95%Masse moléculaire :392.45 g/mol4-(Piperidin-4-yl)benzoic acid hydrochloride
CAS :Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H16ClNO2Degré de pureté :Min. 95%Masse moléculaire :241.71 g/mol3,3'-Dithiodipropionic acid dimethyl ester
CAS :3,3'-Dithiodipropionic acid dimethyl ester is a reactive chemical that can be used as a cross-linking agent. When reacted with an amine group in a protein, the amine is converted to an amide bond and the amino acid becomes covalently attached to the protein. 3,3'-Dithiodipropionic acid dimethyl ester reacts with chloride ions or hydrochloric acid to form a disulfide bond between two proteins. This product is also used as a polymerization initiator for polymers and can be used in the synthesis of hyaluronic acid. 3,3'-Dithiodipropionic acid dimethyl ester has been shown to react with sodium citrate and osmosis to produce sodium hydroxide solution.Formule :C8H14O4S2Degré de pureté :Min. 97%Couleur et forme :Colorless Clear LiquidMasse moléculaire :238.33 g/molFmoc-L-aspartic acid beta-allyl ester
CAS :Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.Formule :C22H21NO6Degré de pureté :Min. 95%Masse moléculaire :395.41 g/molH-Lys-Tyr-OH acetate salt
CAS :H-Lys-Tyr-OH acetate salt (HAT) is a synthetic nonsteroidal anti-inflammatory drug that has been used in the treatment of inflammatory diseases and cancer. HAT is an optical isomer of the naturally occurring amino acid L-lysine. It has been shown to have antioxidative properties and to be active against HIV infection and inflammatory diseases, including diabetes. HAT also has a molecular structure that makes it a potential therapeutic agent for cancer, as well as for women with osteoporosis and other chronic inflammatory conditions.Formule :C15H23N3O4Degré de pureté :Min. 95%Masse moléculaire :309.36 g/molLys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt
CAS :Please enquire for more information about Lys-Lys-IRS-1 (891-902) (dephosphorylated) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H114N18O22Degré de pureté :Min. 95%Masse moléculaire :1,595.79 g/molTri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate
CAS :Tri-tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetate (TBA) is a gadolinium chelate that is used as a contrast agent in magnetic resonance imaging. TBA binds to the malignant cells and shows an increase in uptake of the gadolinium contrast agent. TBA has been shown to be effective in the diagnosis of cancerous brain tissue and is also able to detect cancer cells in animals. TBA has shown some efficacy against bacterial infection by binding to the cell membrane and inhibiting protein synthesis. It is also able to act synergistically with antibiotics such as penicillin or ampicillin to kill bacteria more effectively.Formule :C28H52N4O8Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :572.73 g/molEthoxyiminoacetic acid ethyl ester
CAS :Ethoxyiminoacetic acid ethyl ester is an annulated, lactam-containing compound that is synthesized via the condensation of ethyl thiooxamate and carboxylic acid. This drug has been shown to be efficient in inhibiting the growth of bacteria that are resistant to antibiotics such as polycyclic, triazoles, and condensates. It also inhibits protein synthesis by binding to bacterial DNA gyrase and topoisomerase IV. Ethoxyiminoacetic acid ethyl ester has shown significant antimicrobial activity against Gram-positive bacteria such as streptococci and staphylococci.Formule :C6H11NO3Degré de pureté :Min. 95%Masse moléculaire :145.16 g/molo-Cresol-4-sulphonic acid
CAS :o-Cresol-4-sulphonic acid is a fine chemical with the CAS number 7134-04-5. It is a versatile building block that can be used as a reagent in research, as a speciality chemical and as an intermediate in the production of other compounds. o-Cresol-4-sulphonic acid has been used to synthesize pharmaceuticals, agrochemicals, dyes, perfumes and many more products. This compound has also been used as a reaction component in organic synthesis to form new compounds and scaffolds.Formule :C7H8O4SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :188.2 g/mol(Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
CAS :Please enquire for more information about (Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C142H240N44O38Degré de pureté :Min. 95%Masse moléculaire :3,171.7 g/molC5a Anaphylatoxin (human) trifluoroacetate salt )
CAS :Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C350H578N108O107S8Degré de pureté :Min. 95%Masse moléculaire :8,267.53 g/molAlpha-Helical CRF (12-41) trifluoroacetate salt
CAS :Please enquire for more information about Alpha-Helical CRF (12-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C152H251N43O47S2Degré de pureté :Min. 95%Masse moléculaire :3,497.01 g/mol1-(Mercaptomethyl)cyclopropaneacetic acid
CAS :1-(Mercaptomethyl)cyclopropaneacetic acid is a reaction product of hydrolysis, transfer, and industrialization. It is used in the synthesis of organic compounds such as quinolinediols and thioureas. 1-(Mercaptomethyl)cyclopropaneacetic acid is typically prepared by the reaction of an alkylsulfonyl chloride with an inorganic base such as lithium or sodium carbonate in an organic solvent such as acetonitrile. The compound is also used to produce other organosulfur compounds, including imino sulfides and disulfides.Formule :C6H10O2SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :146.21 g/mol2-Chloropyridine-4-boronic acid
CAS :2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.
Formule :C5H5BClNO2Degré de pureté :Min. 95%Masse moléculaire :157.36 g/molAlloferon 2 trifluoroacetate salt
CAS :Please enquire for more information about Alloferon 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C46H69N19O15Degré de pureté :Min. 95%Masse moléculaire :1,128.16 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS :Produit contrôléPlease enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C33H48N8O8SDegré de pureté :Min. 95%Masse moléculaire :716.85 g/molMca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS :Please enquire for more information about Mca-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C87H129N27O28SDegré de pureté :Min. 95%Masse moléculaire :2,033.19 g/molBoc-N-Methyl-gaMMa-aMinobutyric acid
CAS :Please enquire for more information about Boc-N-Methyl-gaMMa-aMinobutyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C10H19NO4Degré de pureté :Min. 95%Masse moléculaire :217.26 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS :Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C39H60N10O8Degré de pureté :Min. 95%Masse moléculaire :796.96 g/mol3-[(2-Aminoethyl)dithio]propionic acid
CAS :Dithiobis(3-mercaptopropionate) is an analog of 3-[(2-Aminoethyl)dithio]propionic acid (DTA). It has been used as a cross-linking agent for the synthesis of polymers with acidic pH. Dithiobis(3-mercaptopropionate) is also used for the synthesis of conjugates and bifunctional molecules. Dithiobis(3-mercaptopropionate) can be synthesized by reacting bis(sulfanylmethyl)amine with sodium azide in an acidic solution. The cross-linking reaction will produce a disulfide bond, which is a covalent linkage between two cysteine residues in two different polypeptides or proteins. This crosslink is irreversible, so it cannot be broken down by chemical processes, but can be broken down by enzymatic digestion.Formule :C5H11NO2S2Degré de pureté :(%) Min. 95%Couleur et forme :PowderMasse moléculaire :181.28 g/molTetrahydro-3-furoic acid
CAS :Tetrahydro-3-furoic acid is an organic acid that can be found in the form of its tautomers, alpha-methylene-gamma-butyrolactone and 3-hydroxy-2,4-pentadienoic acid. It is a proapoptotic compound that induces cell death in cancer cells by inhibiting protein synthesis. Tetrahydro-3-furoic acid has been shown to have low expression levels in most tissues, with high levels found in the liver. The mechanism behind this inhibition is not yet known but may be due to the formation of a Schiff base between the amine and the carbonyl group of tetrahydro-3-furoic acid. This reaction mechanism has been proposed as a possible explanation for why tetrahydro-3-furoic acid is more toxic than other furoates such as ethyl-, propyl-, butyl-, and amyl-. TetFormule :C5H8O3Degré de pureté :Min. 95%Masse moléculaire :116.12 g/mol1-Methyl-1H-imidazole-5-carboxylic acid
CAS :1-Methyl-1H-imidazole-5-carboxylic acid is an amide that is used as a hardener in medicines. It can be synthesized by the reaction of ethyl formate with thionyl chloride and imidazoles. The yield of this product is high, and it can be produced in different stereoisomeric forms. 1-Methyl-1H-imidazole-5-carboxylic acid is used to produce other medicines, such as painkillers, tranquilizers, diuretics, and antibiotics. This product has been shown to have a number of health benefits, including reducing cholesterol levels and blood pressure.
Formule :C5H6N2O2Degré de pureté :Min. 95%Masse moléculaire :126.11 g/mol1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt
CAS :Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C39H75Na2O8PDegré de pureté :Min. 95%Masse moléculaire :748.96 g/molDnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt
CAS :Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C57H94N22O21Degré de pureté :Min. 95%Masse moléculaire :1,423.49 g/molEtiroxate carboxylic acid
CAS :Please enquire for more information about Etiroxate carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C16H13I4NO4Degré de pureté :Min. 95%Masse moléculaire :790.9 g/molD-Aspartic acid
CAS :D-Aspartic acid is a basic protein that binds to glutamate. It has been shown to be effective in the prevention and treatment of bone cancer in mice. D-Aspartic acid also has an inhibitory effect on the production of estradiol benzoate, which is an enzyme responsible for bone resorption. D-Aspartic acid may also be used as a dietary supplement for bowel disease and bowel motility. D-Aspartic acid has been shown to have receptor activity in humans and to have physiological effects on the locomotor activity of rats. The complex enzyme d-aspartate oxidase can be inhibited by d-aspartic acid.Formule :C4H7NO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :133.1 g/molAbz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS :Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C69H114N26O18Degré de pureté :Min. 95%Masse moléculaire :1,595.81 g/molL(+)-2,3-Diaminopropionic acid HCl
CAS :L(+)-2,3-Diaminopropionic acid HCl is a chiral modifier that is used in the separation of organic compounds. It has been shown to selectively interact with borate, sulfate, and hydroxyapatite. This interaction changes the physical properties of these substances by modifying their surface charge or adsorption capacity. L(+)-2,3-Diaminopropionic acid HCl has also been shown to be useful in diastereoselective reactions. The technique of elution can be used to isolate specific compounds from mixtures using this compound as a modifier. Hydrogen bonding groups and moieties on the functional group are important factors in the specificity of this interaction.END>>Formule :C3H8N2O2·HClDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :140.57 g/molThymosin α1 acetate
CAS :Thymalfasin is a peptide that belongs to the thymosin family. It is a biocompatible polymer with a number of biomedical applications, including as a component in wound dressings and anti-adhesive agents. Thymalfasin has been shown to be effective at inhibiting the replication of influenza A virus, which may be due to its ability to bind to toll-like receptor 4 (TLR4). This drug also has antitumor properties and has been shown to stimulate the production of IL-2 receptor in human monocytes. Thymalfasin also inhibits the growth of cancer cells, such as HL60 cells, by blocking DNA synthesis. The molecular weight of this compound is approximately 20-30 kDa.
Formule :C129H215N33O55•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :3,108.28 g/mol(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS :Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C187H283N51O53SDegré de pureté :Min. 95%Masse moléculaire :4,125.63 g/molAxltide trifluoroacetate salt
CAS :Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C63H107N19O20S2Degré de pureté :Min. 95%Masse moléculaire :1,514.77 g/molH-Lys-Gly-Gly-Lys-OH acetate salt
CAS :Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C16H32N6O5Degré de pureté :Min. 95%Masse moléculaire :388.46 g/mol(Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt
CAS :Produit contrôléPlease enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C66H86N18O12Degré de pureté :Min. 95%Masse moléculaire :1,323.5 g/mol(Deamino-Cys1,b-(3-pyridyl)-D-Ala2,Arg8)-Vasopressin trifluoroacetate salt
CAS :DDAVP is an analogue of vasopressin, which belongs to the class of inositol phosphates. It is a potent agonist for the V1 receptor and has a higher affinity for this receptor than vasopressin. DDAVP also has antagonist properties at the V2 receptor. The biological activity of DDAVP is mediated by its ability to increase phospholipase A2 activity and cause the release of arachidonic acid from membrane phospholipids. This activation causes an increase in prostaglandin synthesis, leading to increased vascular permeability and hypotension. DDAVP may also have antidiuretic effects due to its antagonism of oxytocin receptors.Formule :C45H63N15O11S2Degré de pureté :Min. 95%Masse moléculaire :1,054.21 g/molMethyl-N,N-diethyldithiocarbamate
CAS :Methyl-N,N-diethyldithiocarbamate is a copper complex that reacts with nitrogen atoms to form a stable chemical species. It has been shown to have cancer-fighting properties and is used in the treatment of liver cancer. Methyl-N,N-diethyldithiocarbamate also acts as an anti-inflammatory agent. The mechanism of action of methyl-N,N-diethyldithiocarbamate is not fully understood, but it has been suggested that this compound binds to p450 enzymes and inhibits their activity. This drug may also inhibit the production of carbon disulphide (CS2) by the liver microsomes and the elimination rate of methyl-N,N-diethyldithiocarbamate from rat livers.Formule :C6H13NS2Degré de pureté :Min. 95%Couleur et forme :Colorless PowderMasse moléculaire :163.31 g/molAmyloid beta-Protein (1-40) trifluoroacetate salt
CAS :Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.Formule :C194H295N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,329.81 g/molO-Hippuryl-L-b-phenyllactic acid sodium salt
CAS :Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H16NNaO5Degré de pureté :Min. 95%Masse moléculaire :349.31 g/molAmyloid beta-Protein (25-35) amide trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (25-35) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C45H82N14O13SDegré de pureté :Min. 95%Masse moléculaire :1,059.29 g/molH-Gly-His-Arg-Pro-OH acetate salt
CAS :H-Gly-His-Arg-Pro-OH acetate salt is a synthetic monoclonal antibody that binds to fibrinogen. It has been used in the production of a model protein and as an anticoagulant. H-Gly-His-Arg-Pro-OH acetate salt has been shown to inhibit the growth of tissue plasminogen activator, which is a growth factor for cells involved in blood clotting. This drug also inhibits the release of acetylcholine from nerve cells, which may be due to its ability to bind to plasma proteins.Formule :C19H31N9O5Degré de pureté :Min. 95%Masse moléculaire :465.51 g/molγ-Polyglutamic acid sodium - MW 800-1500
CAS :Polymer of glutamic acid
Formule :(C5H9NO3)nDegré de pureté :Min. 95%Couleur et forme :PowderDibenzoyl-D-(+)-tartaric acid monohydrate
CAS :Dibenzoyl-D-(+)-tartaric acid monohydrate is a weak organic acid that can be used as a neutralizing agent. It has been shown to react with hydrochloric acid, calcium carbonate, and other inorganic acids to form water soluble salts. This compound is also useful for the separation of enantiomers in chromatography and for the determination of the rate of reaction between an organic molecule and an inorganic acid. Dibenzoyl-D-(+)-tartaric acid monohydrate has been used as a template molecule for determining thermodynamic data on various molecules.Formule :C18H14O8·H2ODegré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :376.31 g/molD,L-Mevalonic acid lactone
CAS :Mevalonic acid lactone is a natural compound that has been shown to have an effect on mitochondrial membrane potential. It has also been shown to inhibit the drug transporter P-glycoprotein, which is involved in the transport of drugs out of cells. Mevalonic acid lactone has also demonstrated an anti-inflammatory effect, as it inhibits the production of TNF-α and IL-6 in human serum. This compound also possesses antioxidant properties, which may be due to its hydroxyl group and phenoxy groups. Mevalonic acid lactone can be used as a model system for sesquiterpene lactones, and it is able to improve mitochondrial functions by inhibiting pyrazole ring formation.Formule :C6H10O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :130.14 g/molH-D-Leu-Thr-Arg-pNA acetate salt
CAS :Please enquire for more information about H-D-Leu-Thr-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C22H36N8O6Degré de pureté :Min. 95%Masse moléculaire :508.57 g/mol3-(2-Cyanopropan-2-yl)benzoic acid
CAS :Please enquire for more information about 3-(2-Cyanopropan-2-yl)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C11H11NO2Degré de pureté :Min. 95%Masse moléculaire :189.21 g/molAngiotensin (1-12) (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about Angiotensin (1-12) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C77H109N19O17Degré de pureté :Min. 95%Masse moléculaire :1,572.81 g/molPeptide YY (3-36) trifluoroacetate salt
CAS :Peptide YY (PYY) is a 36-amino acid peptide. It is cleaved from the larger protein, pancreatic polypeptide, by the enzyme dipeptidyl peptidase IV and circulates in plasma as PYY(3-36). The postprandial plasma levels of PYY are dose-dependent and increase with increasing doses of injected PYY. This response reflects the physiological effects of this hormone. A linear regression analysis revealed that PYY(3-36) has a significant effect on body weight loss and body mass index in humans. The effective dose for weight loss is yet to be determined, but it may be higher than 10 μg/kg/day.Formule :C176H272N52O54Degré de pureté :Min. 95%Masse moléculaire :3,980.36 g/mol(D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt
CAS :Please enquire for more information about (D-Ala3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C64H106N22O12Degré de pureté :Min. 95%Masse moléculaire :1,375.67 g/molBiotinyl-Substance P trifluoroacetate salt
CAS :Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.Formule :C73H112N20O15S2Degré de pureté :Min. 95%Masse moléculaire :1,573.93 g/molH-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt
CAS :H-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt (KCTA) is a peptide that belongs to the group of thioneins and is characterized by a high content of lysine, cysteine and histidine residues. This peptide has been shown to be effective in treating subcutaneous tumors in mice. KCTA binds to metallothionein and gamma amino butyric acid (GABA), which are proteins that regulate energy metabolism in cells. KCTA has also been shown to have antimicrobial effects against human serum, which may be due to its ability to bind with thionein.
Formule :C22H41N7O8S3Degré de pureté :Min. 95%Masse moléculaire :627.8 g/molNocistatin (bovine) trifluoroacetate salt
CAS :Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C82H135N21O32Degré de pureté :Min. 95%Masse moléculaire :1,927.07 g/mol3-Maleimidophenyl boronic acid
CAS :Please enquire for more information about 3-Maleimidophenyl boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C10H8NO4BDegré de pureté :Min. 95%Masse moléculaire :216.99 g/molH-Val-Lys-Lys-Arg-OH acetate salt
CAS :Produit contrôléPlease enquire for more information about H-Val-Lys-Lys-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C23H47N9O5Degré de pureté :Min. 95%Masse moléculaire :529.68 g/mol(1-Methyl-1H-pyrazol-4-yl)boronic acid
CAS :(1-Methyl-1H-pyrazol-4-yl)boronic acid is a boronic acid that has been used for the synthesis of a number of heterocyclic compounds. Boronic acids are commonly used to synthesize phosphine ligands, which are reactive and can be used in cross-coupling reactions with organic halides, triflates, and tosylates. The efficiency of the reaction depends on the functional group present on the boron atom. (1-Methyl-1H-pyrazol-4-yl)boronic acid can inhibit the activity of many types of enzymes, including those involved in bacterial DNA synthesis and protein synthesis. (1-Methyl-1H-pyrazol-4-yl)boronic acid has been shown to have pharmacokinetic properties that depend on its ionization state.Formule :C4H7BN2O2Degré de pureté :Min. 95%Masse moléculaire :125.92 g/mol(Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt
CAS :Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C153H225N43O50SDegré de pureté :Min. 95%Masse moléculaire :3,498.75 g/mol(Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Val34)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C193H293N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,315.78 g/mol(Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt
CAS :Please enquire for more information about (Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C167H277N51O49S2Degré de pureté :Min. 95%Masse moléculaire :3,847.43 g/molMca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C55H80N16O16Degré de pureté :Min. 95%Masse moléculaire :1,221.32 g/mol(H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt
CAS :Please enquire for more information about (H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C56H66N10O23Degré de pureté :Min. 95%Masse moléculaire :1,247.18 g/mol
![([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFL110023.webp&w=3840&q=75)
![3-[(2-Aminoethyl)dithio]propionic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFA17745.webp&w=3840&q=75)
