
Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12454 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
BNP-32 (rat) trifluoroacetate
CAS :Trifluoroacetate saltFormule :C146H239N47O44S3Degré de pureté :Min. 95%Masse moléculaire :3,452.95 g/molBiotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-5-aminopentanoyl-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C119H192N38O22S2Degré de pureté :Min. 95%Masse moléculaire :2,571.17 g/molDynorphin A (1-11) amide trifluoroacetate salt
CAS :<p>Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.</p>Formule :C63H104N22O12Degré de pureté :Min. 95%Masse moléculaire :1,361.64 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C54H85N19O13Degré de pureté :Min. 95%Masse moléculaire :1,208.37 g/mol4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid
CAS :4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.Formule :C9H5F3N2O2Degré de pureté :Min. 95%Couleur et forme :White/Off-White SolidMasse moléculaire :230.14 g/mol(2-(2-Methoxyethoxy)ethoxy)acetic acid
CAS :<p>2-(2-Methoxyethoxy)ethoxy)acetic acid (MEAA) is a cell stabilizer that can be used in the treatment of cancer, diabetes, and other diseases. MEAA has been shown to inhibit the growth of cells by binding to and stabilizing the cytoskeleton through inhibition of protein synthesis. It also prevents the activation of pro-inflammatory cytokines and reactive oxygen species. MEAA's magnetic resonance spectroscopy properties have been studied in detail and it has been shown to bind well with silver ions. MEAA has also been shown to have high cytotoxicity when combined with laser ablation therapy.</p>Formule :C7H14O5Degré de pureté :90%Couleur et forme :Clear LiquidMasse moléculaire :178.18 g/molTLQP-21 (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C110H176N40O27Degré de pureté :Min. 95%Masse moléculaire :2,490.83 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :Produit contrôléPlease enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C151H228N40O47Degré de pureté :Min. 95%Masse moléculaire :3,355.67 g/molAzilsartan medoxomil
CAS :<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formule :C30H24N4O8Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :568.53 g/mol4-bromo-5-chloro-2-fluorobenzoic Acid
CAS :Please enquire for more information about 4-bromo-5-chloro-2-fluorobenzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C7H3BrClFO2Degré de pureté :Min. 95%Masse moléculaire :253.45 g/molBz-Val-Gly-Arg-AMC trifluoroacetate salt
CAS :<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>Formule :C30H37N7O6Degré de pureté :Min. 95%Masse moléculaire :591.66 g/mol(+)-3-Bromo-10-camphorsulfonic acid monohydate
CAS :<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C10H15BrO4S•H2ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :329.21 g/molPACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C182H300N56O45SDegré de pureté :Min. 95%Masse moléculaire :4,024.75 g/mol17-alpha,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate
CAS :Produit contrôlé<p>Please enquire for more information about 17-alpha,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C24H30O5Degré de pureté :Min. 95%Masse moléculaire :398.49 g/molBz-Ile-Glu-Gly-Arg-pNA acetate salt
CAS :<p>Bz-Ile-Glu-Gly-Arg-pNA acetate salt is an anticoagulant that binds to heparin. It has been shown to inhibit protease activity in soybean trypsin by binding to the active site of the enzyme. Bz-Ile-Glu-Gly-Arg-pNA acetate salt has also been shown to have a molecular weight of heparin and a protein synthesis inhibition rate of fibrinogen, which is responsible for coagulation.</p>Formule :C32H43N9O9Degré de pureté :Min. 95%Masse moléculaire :697.74 g/molDL-3-Amino-3-phenylpropionic acid
CAS :<p>DL-3-Amino-3-phenylpropionic acid is an amino acid that is synthesized by the reaction of malonic acid and ethyl ester. This compound is a competitive inhibitor of the enzyme pyruvate carboxylase and inhibits this enzyme in the conversion of pyruvic acid to acetyl CoA, which plays a key role in metabolism. DL-3-Amino-3-phenylpropionic acid has been shown to inhibit the growth of bacteria such as Escherichia coli, Salmonella typhimurium and Staphylococcus aureus. The inhibition of pyruvate carboxylase by DL-3-Amino-3-phenylpropionic acid prevents the production of acetaldehyde from pyruvate, which is toxic to cells.</p>Formule :C9H11NO2Degré de pureté :Min. 95%Masse moléculaire :165.19 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS :Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.Formule :C78H123N21O27SDegré de pureté :Min. 95%Masse moléculaire :1,819 g/mol3,5-Diiodothyroformic acid
CAS :<p>3,5-Diiodothyroformic acid is a fine chemical that is used as a versatile building block in organic synthesis. It is also an intermediate for research chemicals and speciality chemicals. In addition to its use as a reagent, 3,5-Diiodothyroformic acid has been shown to be useful as a building block for the synthesis of pharmaceuticals and agricultural chemicals.</p>Formule :C13H8I2O4Degré de pureté :Min. 95%Masse moléculaire :482.01 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS :2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.Formule :C7H5BF4O2Degré de pureté :Min. 95%Masse moléculaire :207.92 g/mol3-Fluoro-4-methoxybenzoic acid
CAS :<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formule :C8H7FO3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :170.14 g/mol(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate
CAS :Produit contrôlé<p>(2S)-beta-Alanyl-L-prolyl-2,4-diamino-N-(phenylmethyl)butanamideacetate (BAP) is a skin care product that can be applied topically to the skin. BAP is an amino acid derivative that has been shown in clinical studies to hydrate the skin. It acts as a humectant and binds to water molecules, thus increasing the moisture content of the skin. This product also has antioxidant and anti-inflammatory properties, as well as anti-aging effects. BAP is often used in cosmetic products for its film forming properties and ability to form polymeric films on the surface of cells.</p>Formule :C21H33N5O5Degré de pureté :Min. 95%Masse moléculaire :435.52 g/mol5-Formyltetrahydropteroic acid
CAS :<p>5-Formyltetrahydropteroic acid is a labile, water soluble compound that can be used as a chromatographic standard. It has been used to determine the purity of water by measuring the concentration of this impurity in the sample. 5-Formyl tetrahydropterin has been shown to inhibit tumor growth and induce apoptosis in cancer cells. This compound also inhibits protein synthesis in cells by inhibiting ribosomal RNA processing and decreasing the rate of protein synthesis. 5-Formyltetrahydropteroic acid is also used to prevent bone marrow from producing red blood cells when given with leucovorin, which prevents the breakdown of bone marrow cells caused by radiation therapy or chemotherapy.</p>Formule :C15H16N6O4Degré de pureté :Min. 95%Masse moléculaire :344.33 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS :Agonist of toll-like receptors TLR1/2Formule :C81H156N10O13SDegré de pureté :Min. 95%Masse moléculaire :1,510.23 g/mol(Tyr9)-β-MSH (porcine) trifluoroacetate salt
CAS :Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C101H140N24O30SDegré de pureté :Min. 95%Masse moléculaire :2,202.4 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS :Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C183H281N57O54S2Degré de pureté :Min. 95%Masse moléculaire :4,207.67 g/molOsteoblast Activating Peptide (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C120H196N38O37Degré de pureté :Min. 95%Masse moléculaire :2,763.07 g/mol([ring-D5]Phe8)-Angiotensin II acetate salt
CAS :<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C50H66D5N13O12Degré de pureté :Min. 95%Masse moléculaire :1,051.21 g/mol4-Amino-3,5,6-trichloropyridine-2-carboxylic acid
CAS :4-Amino-3,5,6-trichloropyridine-2-carboxylic acid (4ATC) is a herbicide that inhibits the activity of pyridoxal phosphate (PLP)-dependent enzymes. 4ATC has been shown to be more toxic to plants than temozolomide and is used in vitro to study the effects of herbicides on cells. It inhibits cell growth and induces apoptosis in human cancer cells. In addition, 4ATC has been shown to inhibit the enzyme activities of group P2 proteins and nucleic acid synthesis. 4ATC also inhibits protein synthesis by inhibiting RNA synthesis in eukaryotic cells. 4ATC is not active against bacteria or fungi.Formule :C6H3Cl3N2O2Degré de pureté :Min. 95%Couleur et forme :White To Tan SolidMasse moléculaire :241.46 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS :Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C97H160N20O24Degré de pureté :Min. 95%Masse moléculaire :1,990.43 g/mol(Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C194H295N53O57S2Degré de pureté :Min. 95%Masse moléculaire :4,345.87 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS :Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).Formule :C23H27NO5Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :397.46 g/mol2-Nitrobenzaldiacetate
CAS :<p>2-Nitrobenzaldiacetate is a chemical compound that has been used as a reaction component and reagent. It is also useful for the synthesis of other compounds. 2-Nitrobenzaldiacetate is a high quality, versatile building block that can be used to make complex compounds. The CAS number for this chemical is 6345-63-7. This compound has been shown to have many uses in research, such as being a useful intermediate or building block in synthetic organic chemistry.</p>Formule :C11H11NO6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :253.21 g/molH-Pro-Pro-Asp-NH2 trifluoroacetate salt
CAS :Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H22N4O5·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :440.37 g/mol(Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt
CAS :Please enquire for more information about (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C145H210N42O45Degré de pureté :Min. 95%Masse moléculaire :3,261.47 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C60H86N16O13Degré de pureté :Min. 95%Masse moléculaire :1,239.42 g/mol7-Amino-3-vinyl-3-cephem-4-carboxylic acid
CAS :7-Amino-3-vinyl-3-cephem-4-carboxylic acid (AVC) is a synthetic, inorganic acid that is used clinically. It is produced by the hydrolysis of chlorocarboxylic acids and has been shown to be effective as an antihypertensive agent. AVC has also been used as a catalyst for acylation reactions with chlorides and trifluoroacetic acid. This process yields a reaction yield that can be up to 95% with the use of catalysts such as aluminum chloride or zinc chloride. AVC has been shown to be an environmentally safe alternative to hydrogen chloride, which has been linked to environmental pollution.Formule :C9H10N2O3SDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :226.25 g/molGly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about Gly-Neuroendocrine Regulatory Peptide-3 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C146H234N46O52Degré de pureté :Min. 95%Masse moléculaire :3,465.7 g/molAmyloid beta-Protein (1-24) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C130H183N35O40Degré de pureté :Min. 95%Masse moléculaire :2,876.06 g/molLHRH (1-2) (free acid) acetate salt
CAS :LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is an analog of the natural hormone LHRH. It is a member of the amide category and has been shown to have a constant level in human serum. LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is resistant to renal proximal tubule uptake and has an acidic pH optimum, which inhibits its uptake into cells. This drug also has an inhibitory effect on the reaction products of hydrogen chloride and proximal tubules.Formule :C11H14N4O4Degré de pureté :Min. 95%Masse moléculaire :266.25 g/molOxalic acid dihydrate
CAS :<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Formule :C2H2O4•(H2O)2Degré de pureté :Min. 95%Masse moléculaire :126.07 g/molCatestatin (human) trifluoroacetate
CAS :<p>Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C104H164N32O27SDegré de pureté :Min. 95%Masse moléculaire :2,326.68 g/molTRAF6 Control Peptide trifluoroacetate salt
CAS :Please enquire for more information about TRAF6 Control Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C139H232N34O42Degré de pureté :Min. 95%Masse moléculaire :3,051.53 g/molNeuropeptide S (rat) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C95H160N34O27Degré de pureté :Min. 95%Masse moléculaire :2,210.5 g/molHomoterephalic acid
CAS :<p>Homoterephalic acid is a polycarboxylic acid. It has been shown to be effective in the treatment of tumors, and in clinical studies, it has been shown to have anti-cancer activity. Homoterephalic acid inhibits the growth of tumor cells by inhibiting the synthesis of l-glutamic acid. This compound also exhibits anti-inflammatory properties by inhibiting tumor necrosis factor alpha (TNFα) production. Homoterephalic acid is also an inhibitor of human lung diastereomer 1210 cells, as well as erythrocytes infected with L1210 leukemia cells. Homoterephalic acid is a substrate for glycinamide ribonucleotide synthetase and can be used for the biosynthesis of thymidylate. It can be used for the synthesis of polycarboxylic acids that are important for cell metabolism and protein synthesis.</p>Formule :C11H12O4Degré de pureté :Min. 95%Masse moléculaire :208.21 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS :<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formule :C12H19NO5Degré de pureté :Min. 95%Masse moléculaire :257.28 g/molAmyloid β-Protein (1-40) (scrambled) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H295N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,329.81 g/molBIM-23627 trifluoroacetate salt
CAS :<p>Please enquire for more information about BIM-23627 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C58H69ClN12O8S2Degré de pureté :Min. 95%Masse moléculaire :1,161.83 g/mol1-Butanesulfonic acid sodium
CAS :1-Butanesulfonic acid sodium salt is a perfluorinated compound that inhibits the activity of various enzymes in the body, such as kinases and phosphatases. It has been used to study the effects of these enzymes on chemical reactions. 1-Butanesulfonic acid sodium salt is also used to detect the presence of selenium compounds in urine samples. The inhibition of an enzyme by this compound results in a decreased rate of reaction and a change in kinetic behavior. This can be observed by measuring the time it takes for the reaction to reach half its maximum value. Sodium taurocholate, chloride, and trifluoroacetic acid are all reagents that are commonly used with this compound when performing kinetic studies. 1-Butanesulfonic acid sodium salt has been shown to inhibit cholesterol synthesis in many animal models. In addition, this compound has been shown to bind to and inhibit plasma mass spectrometry by chromatography on silica gel from human plasmaFormule :C4H10O3S•NaDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :161.18 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS :<p>Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C58H83N17O13Degré de pureté :Min. 95%Masse moléculaire :1,226.39 g/molEthyl 2,4-dichloropyrimidine-5-carboxylate
CAS :Please enquire for more information about Ethyl 2,4-dichloropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C7H6Cl2N2O2Degré de pureté :Min. 95%Masse moléculaire :221.04 g/molNeuropeptide Y (22-36) trifluoroacetate salt
CAS :<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C85H139N29O21Degré de pureté :Min. 95%Masse moléculaire :1,903.2 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS :Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C47H74N10O14SDegré de pureté :Min. 95%Masse moléculaire :1,035.22 g/mol(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H295N53O59SDegré de pureté :Min. 95%Masse moléculaire :4,345.81 g/mol1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic acid 3-methyl ester
CAS :<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>Formule :C16H16N2O6Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :332.31 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS :<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Formule :C6H6F2N2O2Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :176.12 g/mol(S)-(1-boc-pyrrolidin-3-yl)-acetic acid
CAS :<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C11H19NO4Degré de pureté :Min. 95%Masse moléculaire :229.27 g/molD,L-Benzylsuccinic acid
CAS :<p>D,L-Benzylsuccinic acid is an oral hypoglycemic agent that belongs to the group of antidiabetic agents. It is a crystalline cellulose-based drug with a hypoglycemic effect. D,L-Benzylsuccinic acid has been shown to be effective in the treatment of autoimmune diseases, such as diabetes mellitus and rheumatoid arthritis. The mechanism of action of this drug is not yet fully understood.</p>Formule :C11H12O4Degré de pureté :Min. 95%Masse moléculaire :208.21 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS :Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.Formule :C32H49N5O7•C2H4O2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :675.81 g/mol1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid
CAS :<p>Please enquire for more information about 1b-(4-Fluorophenyl)hexahydro-',7-dihydroxy-7-(1-methylethyl)-1a-phenyl-7a-[(phenylamino)carbonyl]-3H-oxireno[3,4]pyrrolo[2,1-b][1,3] oxazine-3-butanoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H35FN2O7Degré de pureté :Min. 95%Masse moléculaire :590.64 g/mol1-Naphthyl acetate
CAS :1-Naphthyl acetate is a cell-permeable esterase substrate that can be used for the treatment of lymphocytic leukemia, lung cancer, and Alzheimer's disease. It has been shown to inhibit tumor growth in mice by inhibiting cytochrome P450 enzymes. In addition, 1-naphthyl acetate has been found to be effective at inhibiting protein kinase activity in human cells. As a result, it may have potential as a therapeutic agent for leukemia and Alzheimer's disease.Formule :C12H10O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :186.21 g/molpTH (28-48) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about pTH (28-48) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C95H150N28O29Degré de pureté :Min. 95%Masse moléculaire :2,148.38 g/molC-Peptide 1 (rat) trifluoroacetate salt
CAS :Please enquire for more information about C-Peptide 1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C140H228N38O51Degré de pureté :Min. 95%Masse moléculaire :3,259.53 g/molGalanin (human) trifluoroacetate salt
CAS :Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C139H210N42O43Degré de pureté :Min. 95%Masse moléculaire :3,157.41 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS :<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C49H75N9O11·C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :1,080.2 g/molSauvagine trifluoroacetate salt
CAS :Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.Formule :C202H346N56O63SDegré de pureté :Min. 95%Masse moléculaire :4,599.31 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS :<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C42H74N10O12SDegré de pureté :Min. 95%Masse moléculaire :943.16 g/molZ-Arg-Arg-Arg-4MbetaNA acetate salt
CAS :Produit contrôlé<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C37H53N13O6Degré de pureté :Min. 95%Masse moléculaire :775.9 g/mol3-Bromobenzoic acid
CAS :<p>3-Bromobenzoic acid is a molecule that is classified as a Group P2. It has an electronegativity of 1.3 and an acidity of 0.8, which are both in the middle range of values for this group. 3-Bromobenzoic acid is soluble in water and is soluble in ethanol, acetone, and ether. The chemical structure of 3-bromobenzoic acid can be determined by its monoclonal antibody binding sites, electrochemical impedance spectroscopy data, and Langmuir adsorption isotherm data. 3-Bromobenzoic acid reacts with hydrochloric acid to form benzoate and HCl gas. Chronic exposure to 3-bromobenzoic acid has been shown to cause glutamate dehydrogenase inhibition, leading to an accumulation of p-hydroxybenzoic acid in the body. This compound also reacts with thiourea or</p>Formule :C7H5BrO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :201.02 g/moltert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate
CAS :Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C11H15BrN2O2SDegré de pureté :Min. 95%Masse moléculaire :319.22 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS :<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formule :C38H52N10O8Degré de pureté :Min. 95%Masse moléculaire :776.88 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C45H81N13O14SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,060.27 g/molDi-tert-butyl azodicarboxylate
CAS :Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalableFormule :C10H18N2O4Degré de pureté :Min. 98%Couleur et forme :PowderMasse moléculaire :230.26 g/mol2-Pyridineboronic acid
CAS :2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.Formule :C5H6BNO2Degré de pureté :Min. 95%Masse moléculaire :122.92 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS :H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.Formule :C23H39N9O10Degré de pureté :Min. 95%Masse moléculaire :601.61 g/mol(Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
Produit contrôléPlease enquire for more information about (Des-Gly10,D-Pyr 1,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C60H86N16O13Degré de pureté :Min. 95%Masse moléculaire :1,239.42 g/mol3-Methoxyphenylboronic acid
CAS :3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.Formule :C7H9BO3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :151.96 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS :Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H23IN4O4Degré de pureté :Min. 95%Masse moléculaire :534.35 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS :Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C85H128N32O20Degré de pureté :Min. 95%Masse moléculaire :1,918.13 g/molDefensin HNP-3 (human) trifluoroacetate salt
CAS :<p>HNP-3</p>Formule :C151H222N44O40S6Degré de pureté :Min. 95%Masse moléculaire :3,486.05 g/molEthyl diphenylacetate
CAS :<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>Formule :C16H16O2Degré de pureté :Min. 95%Masse moléculaire :240.3 g/molSubstance P (5-11) trifluoroacetate salt
CAS :Substance P is a bifunctional neuropeptide that acts as both a neurotransmitter and a neurohormone. The amino acid sequence of Substance P is H-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2. It is found in the brain and spinal cord, but also in other tissues such as the parotid gland and stomach. This peptide is released from nerve cells when they are stimulated by pain or anxiety, and it causes contraction of smooth muscles in the lungs, uterus, and gastrointestinal tract. Animal studies have shown that Substance P can be toxic to neonatal animals, leading to hypothyroidism and death. In vitro studies have shown that this peptide can induce the growth of glioma cells and tumors.Formule :C41H60N10O9SDegré de pureté :Min. 95%Masse moléculaire :869.04 g/molMca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C61H89N17O17Degré de pureté :Min. 95%Masse moléculaire :1,332.46 g/molβ-Casomorphin (1-3) amide acetate salt
CAS :Beta-casomorphin (1-3) amide acetate salt (BCMA) is a peptide that belongs to the class of opioid compounds. It is an amino acid and has been shown to be a potent agonist at opioid receptors. BCMA is used in vivo as a tritiated ligand for mapping the distribution of opioid receptors in rat brain. The affinity of BCMA for opioid receptors increases with dose, and its antinociceptive effects are dose-dependent. Beta-casomorphin (1-3) amide acetate salt has also been shown to have affinity for enkephalins, which are naturally occurring peptides that bind to opioid receptors.Formule :C23H28N4O4Degré de pureté :Min. 95%Masse moléculaire :424.49 g/mol(Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt
Please enquire for more information about (Leu116)-Prepro-Neuromedin U (104-136) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C177H276N46O45Degré de pureté :Min. 95%Masse moléculaire :3,768.37 g/molBig Endothelin-3 (22-41) amide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C102H156N30O31Degré de pureté :Min. 95%Masse moléculaire :2,298.51 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS :<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>Formule :C190H287N55O57Degré de pureté :Min. 95%Masse moléculaire :4,253.65 g/molNeuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C116H170N30O40SDegré de pureté :Min. 95%Masse moléculaire :2,656.84 g/molGlucagon (19-29) (human, rat, porcine) trifluoroacetate salt
CAS :<p>Glucagon is a peptide hormone that belongs to the group of vasoactive intestinal peptides. It is produced by the alpha cells of the pancreas and stimulates gluconeogenesis in the liver, thereby increasing blood glucose levels. Glucagon has also been shown to cause membrane hyperpolarization and cell death in cancer cells. Glucagon is a homologous protein that has been shown to have physiological effects similar to those of insulin, such as increased levels of cytosolic Ca2+ ions and camp levels. Glucagon binds to its receptor on the plasma membrane with high affinity, activating adenylate cyclase and phospholipase C, which leads to an increase in intracellular camp levels. This results in activation of protein kinase A (PKA), which phosphorylates proteins involved in glycogenolysis, glycolysis, and lipolysis. Glucagon also activates mitogen-activated protein kinases (MAPK</p>Formule :C61H89N15O18SDegré de pureté :Min. 95%Masse moléculaire :1,352.52 g/molAc-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS :Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.Formule :C30H46N10O6•C2HF3O2Degré de pureté :Min. 96 Area-%Couleur et forme :PowderMasse moléculaire :756.77 g/mol(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS :Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C26H36N8O5Degré de pureté :Min. 95%Masse moléculaire :540.61 g/molFibronectin Adhesion-Promoting Peptide trifluoroacetate salt
CAS :<p>Fibronectin Adhesion-Promoting Peptide trifluoroacetate salt H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH trifluoroacetate salt (FAP) is a synthetic peptide that promotes fibronectin adhesion. It binds to the amino acid sequence in the C terminal end of fibronectin, which is known to be responsible for binding to actin filaments and growth factors. FAP has been shown to promote wound healing by stimulating the proliferation of corneal epithelial cells in vitro. The mechanism of action of FAP may be due to its ability to bind to chloride ions, which are involved in the regulation of cell proliferation and migration.</p>Formule :C47H74N16O10Degré de pureté :Min. 95%Masse moléculaire :1,023.19 g/molDABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS :<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C76H98N16O15SDegré de pureté :Min. 95%Masse moléculaire :1,507.76 g/molMethyl 2,2-difluoro-2-(fluorosulfonyl)acetate
CAS :Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.Formule :C3H3F3O4SDegré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :192.11 g/molAbz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C35H48N12O12Degré de pureté :Min. 95%Masse moléculaire :828.83 g/mol4-Nitrobenzaldiacetate
CAS :4-Nitrobenzaldiacetate is a crystalline solid that can be obtained by two-dimensional experimental methods. It has been shown to have high reactivity in the presence of ozone and sulfuric acid. The reaction product is the corresponding sulfate salt. The filtration technique is used to separate the desired product from the reaction mixture. This product can also be crystallized with catalytic amounts of sulfuric acid and 4-nitrobenzoic acid. The catalytic oxidation of 4-nitrobenzoic acid to form 4-nitrobenzaldaicetic acid, as well as its subsequent conversion to 4-nitrobenzaldiacetate, are both feasible reactions for this compound.Formule :C11H11NO6Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :253.21 g/molGRF (1-29) amide (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2Formule :C149H246N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,357.88 g/molDnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt
CAS :Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.Formule :C52H77N17O14Degré de pureté :Min. 95%Masse moléculaire :1,164.27 g/mol(Asp371)-Tyrosinase (369-377) (human) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C42H66N10O16S2Degré de pureté :Min. 95%Masse moléculaire :1,031.16 g/mol(Phe1,Ser2)-TRAP-6 trifluoroacetate salt
CAS :<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C34H56N10O9Degré de pureté :Min. 95%Masse moléculaire :748.87 g/mol5-Nitro nicotinic acid
CAS :<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>Formule :C6H4N2O4Degré de pureté :Min. 95%Masse moléculaire :168.11 g/molNeuropeptide AF (human) trifluoroacetate salt
CAS :<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formule :C90H132N26O25Degré de pureté :Min. 95%Masse moléculaire :1,978.17 g/molpTH (1-84) (dog) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C414H672N122O128S2Degré de pureté :Min. 95%Masse moléculaire :9,470.64 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS :Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C194H296N54O57SDegré de pureté :Min. 95%Masse moléculaire :4,328.82 g/mol4-Hydroxyphenylboronic acid
CAS :4-Hydroxyphenylboronic acid is a potential anticancer agent that has been studied in vitro and in vivo. It has been shown to inhibit the activity of p-glycoprotein, which is a protein that pumps drugs out of cells, and it is also an inhibitor of lipid kinase. 4-Hydroxyphenylboronic acid binds to the ATP binding site of the enzyme and forms covalent bonds with Lys residues on the enzyme, inhibiting its function. The compound can be detected at low concentrations using fluorescence or chemiluminescence techniques. This compound may have therapeutic benefits for antimicrobial agents as well as for cancer treatment.Formule :C6H7BO3Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :137.93 g/mol4-(Dodecyloxy)benzoic Acid
CAS :4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.Degré de pureté :Min. 95%Amyloid beta-Protein (1-11) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (1-11) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C56H76N16O22Degré de pureté :Min. 95%Masse moléculaire :1,325.3 g/mol3,5-Dibromobenzoic acid methyl ester
CAS :<p>3,5-Dibromobenzoic acid methyl ester is an organic compound that has isomers. It is a synthetic substance with the chemical formula CHBrO. This substance can be obtained by reacting benzoic acid with bromine in the presence of aluminium chloride. The nature of this substance is not known due to its multifold structure. 3,5-Dibromobenzoic acid methyl ester has been shown to absorb light and transfer it to another molecule. This molecule can then emit light of a different wavelength or energy level. The dipole moment of the substance interacts with other molecules in close proximity, leading to the transfer of electrons and photons from one molecule to another.</p>Formule :C8H6Br2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :293.94 g/mol(D-Phe6,Leu-NHEt 13,des-Met14)-Bombesin (6-14) trifluoroacetate salt
CAS :Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.Formule :C49H69N13O9Degré de pureté :Min. 95%Masse moléculaire :984.15 g/molO-a-Hippuryl-L-argininic acid hydrochloride salt
CAS :Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H20N4O5Degré de pureté :Min. 95%Masse moléculaire :336.34 g/molBiotinyl-pTH (1-34) (human) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C191H305N57O53S3Degré de pureté :Min. 95%Masse moléculaire :4,344.02 g/mol3-Methylbutanoic acid
CAS :3-Methylbutanoic acid is an antimicrobial agent that belongs to the group of isovaleric acids. It is a product of β-oxidation and has been shown to inhibit the growth of bacteria by reacting with their surface. 3-Methylbutanoic acid inhibits bacterial growth by binding to the pyrazole ring in DNA and altering its conformation, preventing DNA replication. This reaction occurs at a rate comparable to that of other fluoroquinolones, such as ciprofloxacin, levofloxacin, and norfloxacin. 3-Methylbutanoic acid has been shown to have antibacterial activity against both Gram-positive and Gram-negative bacteria, particularly those that are resistant to erythromycin or lincomycin.Formule :C5H10O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :102.13 g/molMca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
<p>Please enquire for more information about Mca-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C52H83N19O12Degré de pureté :Min. 95%Masse moléculaire :1,166.34 g/mol1,3-Dithiane-2-carboxylic acid
CAS :<p>1,3-Dithiane-2-carboxylic acid is an alkylating agent that reacts with electron-deficient substrates. It is a convenient way to access enantiopure carboxylates and unsaturated ketones in the presence of amines. This compound can also be used for the preparation of phthalimides and thioacetals. 1,3-Dithiane-2-carboxylic acid is prepared by ring opening of 1,3 dithianes. This reaction can be catalyzed by acids such as hydrochloric acid or pyridine.</p>Formule :C5H8O2S2Degré de pureté :Min. 95%Masse moléculaire :164.25 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C116H176N26O30S2Degré de pureté :Min. 95%Masse moléculaire :2,478.93 g/molNeuromedin N trifluoroacetate salt
CAS :Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.Formule :C38H63N7O8Degré de pureté :Min. 95%Masse moléculaire :745.95 g/mol(±)7-epiJasmonic acid
CAS :<p>(±)7-EpiJasmonic acid is a carotenoid ester that has been found to have biological properties for weed control. It is the methyl ester of jasmonic acid, which is a fatty acid. The compound has been shown to be effective in suppressing plant diseases such as powdery mildew. The chemical transformation of (±)7-epiJasmonic acid can occur through methylation, hydroxylation, or nitro group formation. This process leads to the production of methyl jasmonate and nitrophenol. These compounds have been shown to have fertility effects on lettuce plants by increasing the number of seeds and seedlings produced.</p>Formule :C12H18O3Degré de pureté :Min. 95%Masse moléculaire :210.27 g/molBNP-32 (porcine) trifluoroacetate salt
CAS :BNP-32 is a porcine-specific antibody that is used to detect the presence of BNP in human serum. It is biotinylated and can be coated on a plate. The antibody binds to BNP, which has been labeled with peroxidase, and produces a colored reaction product. This product can be visualized by adding 3,3'-diaminobenzidine (DAB) as a substrate. The sealer then prevents the unbound antibody from binding to the plate and interfering with the assay.Formule :C149H250N52O44S3Degré de pureté :Min. 95%Masse moléculaire :3,570.1 g/mol(D-Arg2)-Kyotorphin acetate salt
CAS :<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>Formule :C15H23N5O4Degré de pureté :Min. 95%Masse moléculaire :337.37 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS :Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C70H114N18O21Degré de pureté :Min. 95%Masse moléculaire :1,543.76 g/mol(Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
Please enquire for more information about (Des-Ser3)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C133H205N39O29SDegré de pureté :Min. 95%Masse moléculaire :2,846.36 g/molγ3-MSH trifluoroacetate salt
CAS :Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C126H188N44O37SDegré de pureté :Min. 95%Masse moléculaire :2,943.18 g/molDnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt
<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C40H64N14O12SDegré de pureté :Min. 95%Masse moléculaire :965.09 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS :<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formule :C61H76N12O14SDegré de pureté :Min. 95%Masse moléculaire :1,233.39 g/moltert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate
CAS :<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H40FN3O6SDegré de pureté :Min. 95%Masse moléculaire :577.71 g/mol2-Hydrazinobenzoic acid hydrochloride - technical grade
CAS :2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.Formule :C7H8N2O2·xHClDegré de pureté :(%) Min. 60%Couleur et forme :PowderMasse moléculaire :188.61 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS :FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.Formule :C22H38N4O3S2Degré de pureté :Min. 95%Masse moléculaire :470.69 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C42H68N14O14SDegré de pureté :Min. 95%Masse moléculaire :1,025.14 g/mol3-Fluoro-2-nitrobenzoic acid
CAS :3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.Formule :C7H4FNO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :185.11 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C23H31N5O6Degré de pureté :Min. 95%Masse moléculaire :473.52 g/mol3,4,5-Trichlorobenzoic acid
CAS :<p>Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END></p>Degré de pureté :Min. 95%Methyl 4-tert-butylphenylacetate
CAS :Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.Formule :C13H18O2Degré de pureté :Min. 95%Masse moléculaire :206.28 g/mol(d(CH2)51,Tyr(Me)2,Thr4, Orn 8,Tyr-NH29)-Vasotocin trifluoroacetate salt
CAS :<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br>br><br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>Formule :C54H79N11O13S2Degré de pureté :Min. 95%Masse moléculaire :1,154.4 g/mol(Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C193H293N53O58SDegré de pureté :Min. 95%Masse moléculaire :4,315.78 g/molBenzopyrazine-6-boronic acidHCl
CAS :<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H8BClN2O2Degré de pureté :Min. 95%Masse moléculaire :210.43 g/molFmoc-D-thiazolidine-4-carboxylic acid
CAS :<p>Please enquire for more information about Fmoc-D-thiazolidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H17NO4SDegré de pureté :Min. 95%Masse moléculaire :355.41 g/molAlloferon - in acetate salt
CAS :<p>Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.</p>Formule :C52H75N22O16Degré de pureté :Min. 95%Masse moléculaire :1,264.29 g/mol5-Bromo-2-fluorobenzoic acid
CAS :5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.Formule :C7H4BrFO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :219.01 g/mol[p-Terphenyl]-4,4''-dicarboxylic acid
CAS :<p>4,4’-Dicarboxy-p-terphenyl is a disulfide amide with the molecular formula C14H10N2O2S. It is a chemical compound that has been shown to have antimicrobial activity. The antibacterial activity of 4,4’-Dicarboxy-p-terphenyl was evaluated by preparing a series of in vitro assays. The results showed that 4,4’-Dicarboxy-p-terphenyl inhibited the growth of bacteria and fungi at concentrations above 10 μg/mL. This drug also has been demonstrated to be effective against trifluoroacetic acid (TFA) induced congestive heart failure in experimental models. 4,4’-Dicarboxy-p-terphenyl has been found to have therapeutic potential for the treatment of metabolic disorders such as diabetes and hypertension. Structural analysis revealed that this drug contains a redox</p>Formule :C20H14O4Degré de pureté :Min. 95%Masse moléculaire :318.32 g/mol4-Bromobutyl acetate
CAS :4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.Formule :C6H11BrO2Degré de pureté :Min. 95%Masse moléculaire :195.05 g/molBiotinyl-Neuropeptide W-23 (human) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C129H197N37O30S2Degré de pureté :Min. 95%Masse moléculaire :2,810.31 g/molPAR-1 (1-6) (mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about PAR-1 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C37H54N10O9Degré de pureté :Min. 95%Masse moléculaire :782.89 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS :Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.Formule :C60H87N19O13Degré de pureté :Min. 95%Masse moléculaire :1,282.45 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C90H151N29O25Degré de pureté :Min. 95%Masse moléculaire :2,039.34 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS :<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C60H95ClN20O12Degré de pureté :Min. 95%Masse moléculaire :1,323.98 g/molTGF α (1-50) (rat) trifluoroacetate salt
CAS :Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C244H361N71O71S6Degré de pureté :Min. 95%Masse moléculaire :5,617.31 g/mol2-Methoxyethyl acetoacetate
CAS :<p>2-Methoxyethyl acetoacetate is used as a raw material for coatings. It has been shown to be an effective calcium antagonist in the treatment of leukemia and other cancers. 2-Methoxyethyl acetoacetate has also been shown to inhibit the growth of HL-60 cells when it is incubated with these cells in the presence of hydrochloric acid, malonic acid, and quinoline derivatives. The reaction produces chlorine gas, which is toxic to cells.</p>Formule :C7H12O4Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :160.17 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C37H56N10O7SDegré de pureté :Min. 95%Masse moléculaire :784.97 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS :Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C21H35N7O6Degré de pureté :Min. 95%Masse moléculaire :481.55 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS :<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C12H14NNaO6SDegré de pureté :Min. 95%Masse moléculaire :323.3 g/molH-Ala-His-Ala-OH acetate salt
CAS :Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C12H19N5O4Degré de pureté :Min. 95%Masse moléculaire :297.31 g/molSpexin trifluoroacetate salt
CAS :Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C74H114N20O19SDegré de pureté :Min. 95%Masse moléculaire :1,619.89 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS :3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.Formule :C17H20O2Degré de pureté :Min. 95%Couleur et forme :White Off-White PowderMasse moléculaire :256.34 g/molAmyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C47H73N11O16SDegré de pureté :Min. 95%Masse moléculaire :1,080.21 g/molThrombin Receptor Antagonist trifluoroacetate salt
CAS :Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C58H91N17O20S2Degré de pureté :Min. 95%Masse moléculaire :1,410.58 g/molBiotinyl-epsilonAhx-ω-Conotoxin GVIA trifluoroacetate salt
CAS :Produit contrôléPlease enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C136H207N41O46S7Degré de pureté :Min. 95%Masse moléculaire :3,376.81 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS :<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H24N2O3Degré de pureté :Min. 95%Masse moléculaire :256.34 g/molZ-Val-Lys-Met-AMC acetate salt
CAS :<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>Formule :C34H45N5O7SDegré de pureté :Min. 95%Masse moléculaire :667.82 g/molEthyl 2-(chlorosulfonyl)acetate
CAS :Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :186.61 g/molDABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt
CAS :Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C73H97N17O18SDegré de pureté :Min. 95%Masse moléculaire :1,532.72 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H46N10O7Degré de pureté :Min. 95%Masse moléculaire :646.74 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C178H293N53O48S2Degré de pureté :Min. 95%Masse moléculaire :4,007.69 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS :Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C25H36N8O7SDegré de pureté :Min. 95%Masse moléculaire :592.67 g/molZ-Gly-Pro-Arg-4MbNA acetate salt
CAS :Produit contrôléPlease enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C32H39N7O6·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :677.75 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS :Used in treatment of nonspecific ulcerative colitisFormule :C18H15N5O6SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :429.41 g/mol3-Fluoro-4-nitrobenzoic acid
CAS :3-Fluoro-4-nitrobenzoic acid is an organic solvent that is used as a reagent in the synthesis of peptidomimetics. 3-Fluoro-4-nitrobenzoic acid has been shown to be a nucleophilic addition agent, which can react with serine proteases in the presence of benzamidine. This reaction results in the formation of an amide bond between the amino group and carboxylic acid moiety of the serine protease, thereby inhibiting its activity. 3-Fluoro-4-nitrobenzoic acid is also used as a synthetic intermediate for peptides and other organic compounds.Formule :C7H4FNO4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :185.11 g/molToxin GaTx1 trifluoroacetate salt
<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C147H224N46O47S9Degré de pureté :Min. 95%Masse moléculaire :3,676.23 g/molRANTES (human) trifluoroacetate salt
<p>Please enquire for more information about RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C350H534N96O100S5Degré de pureté :Min. 95%Masse moléculaire :7,846.9 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS :<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formule :C61H110N24O14Degré de pureté :Min. 95%Masse moléculaire :1,403.68 g/mol2-Bromo-2'-chlorophenyl acetic acid methyl ester
CAS :2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.Formule :C9H8BrClO2Degré de pureté :Min. 95%Masse moléculaire :263.52 g/molEledoisin acetate salt
CAS :Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.Formule :C54H85N13O15S·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :1,188.4 g/molMagnesium acetate anhydrous
CAS :Magnesium acetate anhydrous is the magnesium salt of acetic acid and has been used as a polymerase chain reaction (PCR) buffer for DNA amplification. This product is also used in wastewater treatment to remove organic acids and carbonates from water. Magnesium acetate anhydrous has been shown to have a Langmuir adsorption isotherm that can be described by a single-site binding model with a Kd value of 2.8x10-2 M. The compound was found to bind to liver cells, which may be due to its hydroxyl group on the central atom of the molecule. Magnesium acetate anhydrous has been shown to have electrochemical impedance spectroscopy properties at Ω=1 MΩ-1, which are indicative of ionic conductivity and good chemical stability.Formule :C4H6MgO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :142.39 g/molLys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS :Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.Formule :C47H75N13O11Degré de pureté :Min. 95%Masse moléculaire :998.18 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C195H300N56O56SDegré de pureté :Min. 95%Masse moléculaire :4,356.88 g/mol1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid
CAS :Please enquire for more information about 1-Benzyl-4-((tert-butoxycarbonyl)amino)piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C18H26N2O4Degré de pureté :Min. 95%Masse moléculaire :334.41 g/molOvokinin trifluoroacetate salt
CAS :Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C48H67N13O11Degré de pureté :Min. 95%Masse moléculaire :1,002.13 g/mol3-Hydroxy-3-methylglutaric acid
CAS :<p>3-Hydroxy-3-methylglutaric acid is an organic acid that is a valuable intermediate in the chemical production of epidermal growth factor. 3-Hydroxy-3-methylglutaric acid also has been shown to be useful as a reagent for the detection of bacterial strains, including E. coli, Salmonella enterica, and Pseudomonas aeruginosa. The enzyme activities of 3-hydroxy-3-methylglutaric acid are not well understood, but it has been shown to have effects on congestive heart failure and bowel disease. 3-Hydroxy-3-methylglutaric acid may be used in the treatment of inflammatory bowel disease due to its ability to inhibit certain enzymes responsible for inflammation and pain. The long term toxicity and symptoms associated with 3-hydroxy-3-methylglutaric acid have not yet been studied, but it has been shown to have no effect on cardiac function</p>Formule :C6H10O5Degré de pureté :Min. 95%Masse moléculaire :162.14 g/molZ-Arg-Arg-4MbetaNA acetate salt
CAS :<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C31H41N9O5·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :679.77 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS :Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C63H113N22O25PSDegré de pureté :Min. 95%Masse moléculaire :1,641.74 g/mol4-Methoxycarbonylphenylboronic acid
CAS :4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol. 4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).Formule :C8H9BO4Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :179.97 g/molMethyl 2-bromo-2-(4-chlorophenyl)acetate
CAS :2'-Bromo-4'-chlorophenylacetic acid methyl ester is a versatile building block for the preparation of complex compounds. It is a useful intermediate with speciality chemical properties and can be used to synthesize important reagents, such as 2-Aminobenzonitrile (CAS No. 2601-72-7) and many other fine chemicals. It has been widely used in the synthesis of pharmaceuticals, agrochemicals, and organic intermediates. 2'-Bromo-4'-chlorophenylacetic acid methyl ester is highly soluble in solvents such as DMSO and DMF and can be stored at -20°C for up to one year without changing its chemical properties.Formule :C9H8BrClO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :263.52 g/mol(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS :<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C50H78N14O19Degré de pureté :Min. 95%Masse moléculaire :1,179.24 g/mol4-Methoxybenzylboronic acid pinacolester
CAS :Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H21BO3Degré de pureté :Min. 95%Masse moléculaire :248.13 g/mol(3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt
CAS :Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C63H84N20O13Degré de pureté :Min. 95%Masse moléculaire :1,329.47 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C221H368N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,121.8 g/mol(D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Tyr6,betaPhe11,Phe13, Nle 14)-Bombesin (6-14) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C63H79N13O12Degré de pureté :Min. 95%Masse moléculaire :1,210.38 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%2-Amino-6-fluorobenzoic acid ethyl ester
CAS :<p>2-Amino-6-fluorobenzoic acid ethyl ester is a chemical that can be used as a building block in the synthesis of more complex compounds. It is a versatile intermediate and can be used to synthesize other important compounds, such as pharmaceuticals. This compound has been shown to be useful for the preparation of 2-amino-4,6-difluorobenzoic acid ethyl ester and many other derivatives. The colorless solid is soluble in ether and dichloromethane.</p>Formule :C9H10FNO2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :183.18 g/mol(Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C58H82N14O12Degré de pureté :Min. 95%Masse moléculaire :1,167.36 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS :Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C62H118N40O12S2Degré de pureté :Min. 95%Masse moléculaire :1,679.99 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C195H301N55O56S3Degré de pureté :Min. 95%Masse moléculaire :4,408.01 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS :<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C215H355N63O54SDegré de pureté :Min. 95%Masse moléculaire :4,718.58 g/molGLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt is a posttranslational modification of the endogenous human hormone GLP-1. It is a synthetic form of this hormone that has been modified to allow for improved stability and solubility. This peptide is found in the pancreatic alpha cells and intestinal L cells and stimulates the release of insulin from pancreatic beta cells. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt has also been shown to increase glucose uptake by muscle tissue as well as stimulate the release of incretin hormones such as glucagon-like peptide 1 and gastric inhibitory polypeptide. GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate saltFormule :C186H275N51O59Degré de pureté :Min. 95%Masse moléculaire :4,169.48 g/mol(D-Trp6)-LHR
Please enquire for more information about (D-Trp6)-LHR including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C83H115N25O17Degré de pureté :Min. 95%Masse moléculaire :1,734.96 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C69H85FN16O13Degré de pureté :Min. 95%Masse moléculaire :1,365.51 g/mol3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid
CAS :<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>Formule :C12H12O4F2Degré de pureté :Min. 95%Couleur et forme :White/Off-White SolidMasse moléculaire :258.22 g/moltrans 4-Dimethylaminocrotonic acid HCl
CAS :<p>Intermediate in the synthesis of afatinib</p>Formule :C6H12ClNO2Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :165.62 g/mol7-Hydroxynaphthalene-1-sulfonic acid
CAS :<p>7-Hydroxynaphthalene-1-sulfonic acid is a chemical compound with the formula HNSO. It is an organic compound and a proton acceptor. The conjugate base of 7-hydroxynaphthalene-1-sulfonic acid has a strong absorption band in the ultraviolet region. In DMF solution, the reaction of 7-hydroxynaphthalene-1-sulfonic acid with formamide, hydroxy, and nitrogen atoms produces a product that has been characterized by photoexcitation and kinetic studies. The proton transfer process from formamide to 7-hydroxynaphthalene-1-sulfonic acid was found to be exponential and followed first order kinetics. The protonation constant for this process was determined to be 8.4 x 10 M/equivalent. 7HNSO can also act as an electron acceptor in dimethylsulphoxide (DMSO) solution</p>Degré de pureté :Min. 95%Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt
CAS :Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C123H193N37O26SDegré de pureté :Min. 95%Masse moléculaire :2,638.15 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C133H229N45O37Degré de pureté :Min. 95%Masse moléculaire :3,050.52 g/molKyotorphin acetate salt
CAS :Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H23N5O4Degré de pureté :Min. 95%Masse moléculaire :337.37 g/mol
