Acides carboxyliques
Les acides carboxyliques sont des molécules organiques caractérisées par un groupe fonctionnel de type carboxyle (-COOH). Ces acides sont fondamentaux dans diverses réactions chimiques, y compris l'estérification, l'amidation et la décarboxylation. Les acides carboxyliques sont largement utilisés dans la production de produits pharmaceutiques, de polymères et d'agrochimiques. Dans cette section, vous pouvez trouver un grand nombre d'acides carboxyliques prêts à l'emploi. Chez CymitQuimica, nous fournissons une large gamme d'acides carboxyliques de haute qualité pour soutenir vos applications de recherche et industrielles.
12457 produits trouvés pour "Acides carboxyliques"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Alpha-Conotoxin MI trifluoroacetate salt
CAS :Produit contrôléA component of Conus venom; antagonist of nicotinic acetylcholine receptorsFormule :C58H88N22O17S4Degré de pureté :Min. 95%Masse moléculaire :1,493.72 g/molAPL1b27 trifluoroacetate salt
CAS :Please enquire for more information about APL1b27 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C103H174N30O38SDegré de pureté :Min. 95%Masse moléculaire :2,472.73 g/mol(Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS :Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C195H300N54O56SDegré de pureté :Min. 95%Masse moléculaire :4,328.86 g/mol2-Hydroxyethanesulfonic acid sodium salt
CAS :2-Hydroxyethanesulfonic acid sodium salt is a drug that is used to treat metabolic disorders such as cystinuria and hyperchloremic metabolic acidosis. It is also used for the treatment of water-vapor related respiratory problems and cataracts, as well as for the prevention of renal stone formation. This drug is made through electrochemical impedance spectroscopy of taurine in reaction solution with phosphorus pentoxide. 2-Hydroxyethanesulfonic acid sodium salt has been shown to increase locomotor activity in rats by improving their biochemical properties. This compound binds to the chloride ion receptor site on the Na+/K+ ATPase, causing an inhibition of the enzyme's function.Formule :C2H5O4S·NaDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :148.11 g/mol5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS :Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C89H138N34O18Degré de pureté :Min. 95%Masse moléculaire :1,972.27 g/molProadrenomedullin (1-20) (rat) trifluoroacetate salt
CAS :Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C111H177N37O28Degré de pureté :Min. 95%Masse moléculaire :2,477.83 g/molDiethyldithiocarbamic acid sodium trihydrate
CAS :Diethyldithiocarbamic acid sodium salt trihydrate (DDC) is an inhibitor of the response element that belongs to a class of pharmacological agents called diethyldithiocarbamates. DDC inhibits the growth of tumor cells by blocking enzyme activities and decreasing the production of GSH-Px enzymes, which are required for cellular protection against oxidative stress. DDC is also a potent inducer of experimental models for myocardial infarcts. The matrix effect is another mechanism by which DDC exerts its antitumor activity. This effect is due to its ability to inhibit protein synthesis in tumor cells and its ability to inhibit the synthesis of collagen in endothelial cells, thereby preventing angiogenesis.Formule :C5H11NS2•Na•(H2O)3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :226.32 g/mol(Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt
CAS :Please enquire for more information about (Lys1015·1024)-Thrombospondin-1 (1015-1024) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C68H105N17O12SDegré de pureté :Min. 95%Masse moléculaire :1,384.73 g/mol(Lys4)-Sarafotoxin C acetate salt
CAS :A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.Formule :C105H153N27O36S5Degré de pureté :Min. 95%Masse moléculaire :2,529.83 g/molH-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt
CAS :Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C34H46N8O10Degré de pureté :Min. 95%Masse moléculaire :726.78 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS :Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C180H276N54O55SDegré de pureté :Min. 95%Masse moléculaire :4,108.51 g/molEthyl 4-methoxyphenylacetate
CAS :Ethyl 4-methoxyphenylacetate is a fatty acid that is synthesized by the condensation of aniline and pyrrole. It has been shown to inhibit the growth of bacteria, such as Salmonella typhi and Staphylococcus aureus, in vitro. The inhibition of bacterial growth is thought to be due to its ability to react with hydrogen fluoride, which results in the formation of reactive oxygen species and nitrogen radicals. This compound also inhibits the production of tyrosinase in human skin cells, which may be beneficial for individuals with acne. Ethyl 4-methoxyphenylacetate has been shown to be safe for use in clinical trials.Formule :C11H14O3Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :194.23 g/molAmyloid beta-Protein (1-24) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C130H183N35O40Degré de pureté :Min. 95%Masse moléculaire :2,876.06 g/molBig Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt )
CAS :Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C162H236N38O47S5Degré de pureté :Min. 95%Masse moléculaire :3,628.17 g/mol2-Hydroxysuccinic acid methyl ester
CAS :2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.
Formule :C5H8O5Degré de pureté :90% MinMasse moléculaire :148.11 g/mol5-FAM-Woodtide trifluoroacetate salt
CAS :Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C89H133N21O26SDegré de pureté :Min. 95%Masse moléculaire :1,945.2 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS :Amide; Trifluoroacetate saltFormule :C64H109N19O24SDegré de pureté :Min. 95%Masse moléculaire :1,560.73 g/molH-Thr-Lys-Pro-Pro-Arg-OH acetate salt
CAS :Produit contrôléPlease enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C26H47N9O7Degré de pureté :Min. 95%Masse moléculaire :597.71 g/molH-Pro-Pro-Asp-NH2 trifluoroacetate salt
CAS :Please enquire for more information about H-Pro-Pro-Asp-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H22N4O5·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :440.37 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS :Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H30N4O5Degré de pureté :Min. 95%Masse moléculaire :406.48 g/mol(d(CH2)51,Tyr(Me)2,Thr4, Orn 8,Tyr-NH29)-Vasotocin trifluoroacetate salt
CAS :Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br>br> Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylamFormule :C54H79N11O13S2Degré de pureté :Min. 95%Masse moléculaire :1,154.4 g/molBradykinin (2-9) acetate salt
CAS :Acetate saltFormule :C44H61N11O10Degré de pureté :Min. 95%Masse moléculaire :904.02 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS :Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C27H36N8O7Degré de pureté :Min. 95%Masse moléculaire :584.62 g/molAmylin (mouse, rat) trifluoroacetate
CAS :Amylin (mouse, rat) trifluoroacetate is a synthetic peptide, which is a derivative of the islet amyloid polypeptide (IAPP) found in rodent species. It is sourced from the pancreatic beta cells of mice and rats, where it is co-secreted with insulin. The mode of action involves regulation of glucose metabolism through its effects on gastric emptying, glucagon secretion, and satiety. These actions are crucial in managing postprandial blood glucose levels and provide insights into the pathophysiology of diabetes.Amylin (mouse, rat) trifluoroacetate is primarily used in research applications to study the mechanisms of amylin aggregation and its implications in type 2 diabetes. It also serves as a model for understanding the differences in amyloid fibril formation between human and rodent amylin, making it invaluable for the development of therapeutic strategies aimed at mitigating amyloid-related cellular toxicity. Researchers utilize this peptide to explore the potential compensatory roles of amylin analogs in diabetic models, advancing our understanding of diabetes progression and treatment options.Formule :C167H272N52O53S2•(C2HF3O2)xDegré de pureté :Min. 95%Masse moléculaire :3,920.4 g/molMAGE-1 Antigen (161-169) (human) acetate salt
CAS :MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.Formule :C41H57N11O17Degré de pureté :Min. 95%Masse moléculaire :975.96 g/mol(+)-3-Bromo-10-camphorsulfonic acid monohydate
CAS :Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C10H15BrO4S•H2ODegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :329.21 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C134H180N34O26S2Degré de pureté :Min. 95%Masse moléculaire :2,747.21 g/mol(D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt
CAS :Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C41H62N12O11Degré de pureté :Min. 95%Masse moléculaire :899.01 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :Produit contrôléPlease enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C151H228N40O47Degré de pureté :Min. 95%Masse moléculaire :3,355.67 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS :Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C13H25N7O5Degré de pureté :Min. 95%Masse moléculaire :359.38 g/moltert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate
CAS :Please enquire for more information about tert-Butyl trans-4-(hydroxymethyl)cyclohexylcarbamate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C12H23NO3Degré de pureté :Min. 95%Masse moléculaire :229.32 g/molIDR-1 trifluoroacetate salt
CAS :IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.Formule :C65H118N18O15Degré de pureté :Min. 95%Masse moléculaire :1,391.74 g/molH-Gly-Gly-Lys-OH acetate salt
CAS :Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C10H20N4O4Degré de pureté :Min. 95%Masse moléculaire :260.29 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS :Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.Formule :C32H49N5O7•C2H4O2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :675.81 g/molNaphthenic acid
CAS :Naphthenic acid is a metal chelate that is used in synchronous fluorescence spectroscopy. It has been shown to have biodegradation properties and can be used as an indicator for water quality. Naphthenic acid has been found to be a potent inhibitor of corrosion and is often used as an additive to petroleum products, such as gasoline, that are made from crude oil. Naphthenic acid also has acute toxicities and can cause toxicity studies on humans. It is able to inhibit energy metabolism in cells by binding to the mitochondrial membrane, which may be due to its ability to bind with benzalkonium chloride. Naphthenic acid can also be used for analytical methods, such as electrochemical impedance spectroscopy, because it has high sensitivity and specificity.
Formule :C7H10O2Couleur et forme :Clear LiquidMasse moléculaire :126.15 g/molMca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt
CAS :Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-674)-Dap (Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C56H73N13O26Degré de pureté :Min. 95%Masse moléculaire :1,344.25 g/mol(Tyr9)-beta-MSH (porcine) trifluoroacetate salt
CAS :Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C101H140N24O30SDegré de pureté :Min. 95%Masse moléculaire :2,202.4 g/molConjugated linoleic acid - liquid
CAS :Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)
Formule :C18H32O2Degré de pureté :Min. 95%Couleur et forme :Slightly Yellow Clear LiquidMasse moléculaire :280.45 g/molOsteostatin (human) trifluoroacetate salt
CAS :Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.Formule :C142H228N42O58Degré de pureté :Min. 95%Masse moléculaire :3,451.58 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS :Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.Formule :C34H41N3O6Degré de pureté :Min. 95%Masse moléculaire :587.71 g/mol4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt
CAS :4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt is a synthetic, hydroxamic acid that inhibits the activity of collagenase, gelatinase and stromelysin. It also has inhibitory activities against metalloproteinases, such as matrix metalloproteinases and serine proteinases. 4-Abz-Gly-Pro-D-Leu-D-Ala-NHOH trifluoroacetate salt has been shown to inhibit the production of proinflammatory cytokines in human skin fibroblasts. This agent also induces the production of granulocytes in vitro.Formule :C23H34N6O6Degré de pureté :Min. 95%Masse moléculaire :490.55 g/mol4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester
CAS :Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C21H33BN2O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :388.31 g/molGRF (bovine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C220H366N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,107.77 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS :Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H226N42O39Degré de pureté :Min. 95%Masse moléculaire :3,229.65 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS :Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C56H78N16O13Degré de pureté :Min. 95%Masse moléculaire :1,183.32 g/mol(Ala13)-Apelin-13 (human, bovine, mouse, rat) acetate salt
CAS :Apelin-13 is a peptide hormone that is secreted from the stomach and small intestine. It may have analgesic effects through its interaction with μ-opioid receptors, which are also activated by morphine. Apelin-13 has been shown to increase locomotor activity in rats, suggesting it can potentiate the antinociceptive effect of morphine.Formule :C63H107N23O16S·xC2H4O2Degré de pureté :Min. 95%Masse moléculaire :1,474.74 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS :Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H77N9O12SDegré de pureté :Min. 95%Masse moléculaire :1,028.27 g/molH-Gly-Phe-NH2 acetate salt
CAS :Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C11H15N3O2·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :281.31 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C184H273N51O57Degré de pureté :Min. 95%Masse moléculaire :4,111.45 g/moltrans-2,5-Difluorocinnamic acid
CAS :Trans-2,5-difluorocinnamic acid is a monomer that belongs to the group of organic acids. It is used as a solvent and in analytical methods. Trans-2,5-difluorocinnamic acid is also used to transport other substances and can be used in reactions with other molecules. Trans-2,5-difluorocinnamic acid has been shown to be neuropathic and has been tested for its ability to cause cataracts, but has not shown any evidence of mutagenicity.
Formule :C9H6F2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :184.14 g/mol
![4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN162753.webp&w=3840&q=75)
