Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
FBXL10 antibody
FBXL10 antibody was raised in rabbit using the middle region of FBXL10 as the immunogenDegré de pureté :Min. 95%SLC25A39 antibody
SLC25A39 antibody was raised using the C terminal of SLC25A39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFDegré de pureté :Min. 95%GORASP1 antibody
GORASP1 antibody was raised in rabbit using the N terminal of GORASP1 as the immunogenDegré de pureté :Min. 95%Plasminogen antibody
Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
Degré de pureté :Min. 95%IL6 antibody
IL6 antibody was raised in goat using highly pure recombinant human IL-6 as the immunogen.
REG1B antibody
REG1B antibody was raised using the N terminal of REG1B corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFDegré de pureté :Min. 95%SLC5A11 antibody
SLC5A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVL
Degré de pureté :Min. 95%AIM2 antibody
AIM2 antibody was raised in rabbit using the N terminal of AIM2 as the immunogenDegré de pureté :Min. 95%CKAP4 antibody
CKAP4 antibody was raised using the middle region of CKAP4 corresponding to a region with amino acids SDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEDegré de pureté :Min. 95%GABARAP antibody
GABARAP antibody was raised in rabbit using the C terminal of GABARAP as the immunogenDegré de pureté :Min. 95%SLC19A3 antibody
SLC19A3 antibody was raised using the middle region of SLC19A3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGYDegré de pureté :Min. 95%KCNJ12 antibody
KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARDegré de pureté :Min. 95%SLC22A6 antibody
SLC22A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQADegré de pureté :Min. 95%Sesn1 antibody
Sesn1 antibody was raised in rabbit using the C terminal of Sesn1 as the immunogenDegré de pureté :Min. 95%ZFP92 antibody
ZFP92 antibody was raised in rabbit using the middle region of ZFP92 as the immunogenDegré de pureté :Min. 95%SLC39A5 antibody
SLC39A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGDegré de pureté :Min. 95%Annexin A8-Like 2 antibody
Annexin A8-Like 2 antibody was raised using the middle region of ANXA8L2 corresponding to a region with amino acids VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYADegré de pureté :Min. 95%DPP6 antibody
DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPTDegré de pureté :Min. 95%ZNF429 antibody
ZNF429 antibody was raised in rabbit using the N terminal of ZNF429 as the immunogenDegré de pureté :Min. 95%
