Anticorps primaires

FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY

ASPA antibody was raised in Rabbit using Human ASPA as the immunogen

Rabbit polyclonal RPS26 antibody

PTGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE

The Anti-HIV p24 antibody is a powerful tool in the fight against HIV. This monoclonal antibody specifically targets the p24 protein, which is an essential component of the HIV virus. By binding to this protein, the antibody prevents the virus from replicating and spreading throughout the body. In addition to its antiviral properties, the Anti-HIV p24 antibody has been shown to have other beneficial effects. It has been found to inhibit epidermal growth factor signaling, which is involved in cell proliferation and survival. This can help prevent the spread of cancer cells and may have potential applications in cancer treatment. Furthermore, studies have shown that this antibody can enhance the effectiveness of other targeted therapies, such as trastuzumab for HER2-positive breast cancer. By combining these treatments, researchers have observed improved outcomes and increased patient survival rates. The Anti-HIV p24 antibody also has potential diagnostic applications. It can be used in laboratory tests to detect the presence of HIV infection by binding

Luteinizing hormone beta antibody was raised in mouse using human LH as the immunogen.

Mouse monoclonal STAT4 antibody

Mouse monoclonal alpha Tubulin antibody (biotin)

The Human Kappa light chain antibody is a monoclonal antibody that specifically targets the kappa light chain of human antibodies. This antibody is widely used in Life Sciences research to study various aspects of human immune response and antibody production.

The ATXN3 antibody is a highly specific monoclonal antibody that targets the ATXN3 antigen. It is commonly used in research and diagnostic applications to detect the presence of autoantibodies against ATXN3. This antibody has been extensively validated for use in immunohistochemistry experiments, allowing researchers to study the distribution and localization of ATXN3 in various tissues and cell types.

MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST

Affinity purified Rabbit polyclonal DUSP7 antibody

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Affinity purified Rabbit polyclonal CAMK1D antibody

ART3 antibody was raised in Rabbit using Human ART3 as the immunogen

The HSF1 antibody is a medicament that consists of dimers with an amino-terminal domain. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α) and natriuretic peptides. This glycoprotein antibody is widely used in Life Sciences research for its ability to detect and quantify specific proteins in various biological samples. The HSF1 antibody can be used in applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The HSF1 antibody's high specificity and sensitivity make it an essential tool for studying cellular processes and protein functions. With its advanced glycosylation techniques, this antibody ensures accurate results by minimizing non-specific binding and interference from other molecules.

ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

BATF antibody was raised in Rabbit using Human BATF as the immunogen

CAPN7 antibody was raised in Rabbit using Human CAPN7 as the immunogen

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR