Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75560 produits trouvés pour "Anticorps primaires"
Goat anti Rat IgG (H + L) (Fab'2) (rhodamine)
Goat anti-rat IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.
Degré de pureté :Min. 95%CMV antibody (biotin)
CMV antibody (biotin) was raised in goat using purified virions of strain AD169 as the immunogen.GNL3L antibody
GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
Apelin Receptor antibody
Apelin Receptor antibody is a monoclonal antibody that specifically targets the apelin receptor, a G-protein coupled receptor involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to alpha-fetoprotein, acidic androgen protein, autoantibodies, lysozyme, leukemia inhibitory factor, glycosylation, arginase, and other related factors. The Apelin Receptor antibody is widely used as a research tool for studying the role of apelin signaling pathways and its potential therapeutic applications. With its high specificity and inhibitory effects on apelin receptor activation, this antibody offers valuable insights into understanding the complex mechanisms underlying various biological processes.
PPIL3 antibody
PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Degré de pureté :Min. 95%Oxytocin antibody
The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.
PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Degré de pureté :Min. 95%Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody that targets the thyroid peroxidase enzyme. This enzyme plays a crucial role in the synthesis of thyroid hormones. By binding to the enzyme, Thyroid Peroxidase antibody inhibits its activity, leading to a decrease in thyroid hormone production. This antibody has been extensively used in research and diagnostic applications in the field of Life Sciences. It has shown great potential for studying cholinergic signaling pathways, genotoxic effects, fatty acid metabolism, and neutralizing specific proteins such as collagen and acetylcholine. With its high specificity and affinity, Thyroid Peroxidase antibody is an essential tool for researchers working in various areas of biology and medicine.AND1 antibody
AND1 antibody was raised in mouse using Nuclear fraction prepared from Xenopus laevis oocytes as the immunogen.L1CAM antibody
The L1CAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets L1CAM, a glycoprotein involved in cell adhesion and migration. This antibody has been extensively studied and proven to be effective in various applications.
