Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75560 produits trouvés pour "Anticorps primaires"
Moesin antibody
Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.PARD6B antibody
PARD6B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV
IL3 antibody
IL3 antibody is a polyclonal antibody that specifically targets and binds to IL3, a cytokine involved in the regulation of hematopoiesis. This antibody has been shown to effectively disrupt the interaction between IL3 and its receptor, leading to the inhibition of downstream signaling pathways. It can be used for various applications, such as immunohistochemistry, immunofluorescence, and western blotting. The IL3 antibody has high affinity and specificity for IL3, ensuring reliable and accurate detection. Whether you're studying the role of IL3 in cancer progression or investigating its potential as a therapeutic target, this antibody is an essential tool for your research. With its robust performance and consistent results, the IL3 antibody will help advance your understanding of hematopoiesis and contribute to scientific breakthroughs in the field.
PDLIM1 antibody
PDLIM1 antibody was raised in rabbit using the middle region of PDLIM1 as the immunogen
Degré de pureté :Min. 95%Proteasome 20S antibody
Proteasome 20S antibody was raised in rabbit using a Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2 as the immunogen.
Degré de pureté :Min. 95%TAP antibody
The TAP antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications. This antibody is specifically designed to target and neutralize epidermal growth factor (EGF) and hepatocyte growth factor (HGF), two important growth factors involved in various biological processes.
LZTFL1 antibody
LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
IL2Ra antibody
IL2Ra antibody was raised in mouse using recombinant human soluble IL-2 Receptor alpha as the immunogen.
