Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
Vasopressin antibody
Vasopressin antibody was raised in rabbit using arginine vasopressin-thyroglobulin as the immunogen.
Degré de pureté :Min. 95%CD8a antibody (CY5)
CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Degré de pureté :Min. 95%IKB alpha antibody
The IKB alpha antibody is a highly specialized monoclonal antibody that targets and binds to the inhibitor of kappa B alpha (IKBα) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It is widely used in research laboratories for the detection and analysis of IKBα in different biological samples.
Degré de pureté :Min. 95%SLC5A9 antibody
SLC5A9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%FAM13C1 antibody
FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
ATP6V1B2 antibody
ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
