CymitQuimica logo
Anticorps primaires

Anticorps primaires

Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.

Sous-catégories appartenant à la catégorie "Anticorps primaires"

Affichez 1 plus de sous-catégories

75447 produits trouvés pour "Anticorps primaires"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • Plakophilin 2 antibody


    Plakophilin 2 antibody was raised in Guinea Pig using human synthetic plakophilin 2 as the immunogen.
    Degré de pureté :Min. 95%

    Ref: 3D-20R-2656

    Produit arrêté
  • DNAJA2 antibody


    Mouse monoclonal DNAJA2 antibody

    Ref: 3D-10R-3845

    Produit arrêté
  • F2RL2 antibody


    Rabbit polyclonal F2RL2 antibody

    Ref: 3D-70R-32465

    Produit arrêté
  • A2M antibody


    The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.

    Degré de pureté :Min. 95%
  • COL11A1 antibody


    The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.

    Ref: 3D-70R-49577

    Produit arrêté
  • ASB6 antibody


    ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV
    Degré de pureté :Min. 95%

    Ref: 3D-70R-5879

    Produit arrêté
  • EPSP synthase antibody


    Mouse monoclonal EPSP synthase antibody

    Ref: 3D-10-1405

    Produit arrêté