Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75512 produits trouvés pour "Anticorps primaires"
Mycoplasma pneumoniae antibody
Mycoplasma pneumoniae antibody is a monoclonal antibody that specifically targets the mineralocorticoid receptor. This antibody can be used for various applications, including coagulation studies, as it has been shown to have neutralizing effects on mineralocorticoid activity. Additionally, Mycoplasma pneumoniae antibody has been used in the development of therapeutic strategies for diseases associated with low-density lipoprotein (LDL) metabolism and autoantibodies targeting extracellular protein complexes. This antibody is a valuable tool in research and clinical settings for studying the role of mineralocorticoids and their interactions with other molecules in various disease processes.IVD antibody
IVD antibody is a reactive growth factor that belongs to the class of monoclonal antibodies. It specifically targets cysteine-rich proteins and can be used to detect autoantibodies in various assays. The IVD antibody has high affinity for tumor necrosis factor-alpha (TNF-α), a glycoprotein involved in inflammation and immune response. This antibody can be used in immunohistochemistry, Western blotting, and other techniques such as electrophoresis to study protein expression and localization. Additionally, the IVD antibody has been shown to modulate transmembrane conductance and act as an angiogenic inducer by targeting chemokines and activated cells. Overall, this versatile monoclonal antibody offers a valuable tool for researchers studying various biological processes and diseases.
Goat anti Human IgG (H + L) (FITC)
Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.
Degré de pureté :Min. 95%BAG3 antibody
BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
Degré de pureté :Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
