Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75512 produits trouvés pour "Anticorps primaires"
RAB5a antibody
RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.
Troponin T Type 2 antibody
Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
ACTL6B antibody
ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS
CHRNA5 antibody
CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
PTBP2 antibody
PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE
Calcitonin antibody
Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.
TCP10 antibody
TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH
CLPP antibody
The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.
RBP1 antibody
The RBP1 antibody is a highly specialized polyclonal antibody that is used in various life sciences assays. It is specifically designed to target and bind to the RBP1 protein, which plays a crucial role in glucose transportation and dopamine regulation. This antibody is produced by immunizing animals with the specific antigen, resulting in the generation of high-affinity antibodies that can recognize and bind to the target protein.
