Anticorps primaires

The NTRK2 antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is an antibody that specifically targets and binds to the NTRK2 protein, which is involved in various cellular processes. This polyclonal antibody can be used for research purposes, such as studying the function and expression of NTRK2 in different cell types and tissues.

Rabbit polyclonal TNFRSF13B antibody

Purified Polyclonal PPP4R1L antibody

Affinity purified Rabbit polyclonal DPYD antibody

RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR

Affinity purified Rabbit polyclonal XPR1 antibody

The RNASE1 antibody is a monoclonal antibody that specifically targets and binds to RNASE1, an enzyme involved in the breakdown of RNA molecules. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas.

FOXO1 antibody was raised in Rabbit using Human FOXO1 as the immunogen

MCP4 antibody was raised in mouse using highly pure recombinant human MCP-4 as the immunogen.

HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

CHCHD6 antibody was raised in Rabbit using Human CHCHD6 as the immunogen

FAM120A antibody was raised in Rabbit using Human FAM120A as the immunogen

The KLK6 antibody is an extracellular antibody that is primarily used in neuronal cultures for research purposes. This antibody specifically targets the phosphorylation site of KLK6, a protein that plays a crucial role in various biological processes within the Life Sciences field. KLK6 is known to interact with growth factors and synaptic proteins, and its activity has been linked to exocytosis and vesicular trafficking. By targeting KLK6, this polyclonal antibody can help researchers gain insights into the mechanisms of inhibitory neurotransmission and the regulation of protein isoforms. Additionally, it can be used to study the involvement of KLK6 in protein kinase signaling pathways.

Rabbit polyclonal CSFR antibody (Tyr561)

Rabbit polyclonal Horse Serum Albumin antibody

14.3.3 beta antibody is apolyclonal antibody, which is generated in rabbit and specifically targets the 14-3-3 beta protein isoform.The mode of action involves the binding of the antibody to the 14-3-3 beta protein, a member of the 14-3-3 protein family, which is known for its role in regulating a broad range of cellular processes, including signal transduction, apoptosis, and cell cycle control. Upon binding, the antibody can be utilized in various detection methods such as Western blotting, immunohistochemistry, or immunoprecipitation.The 14.3.3 beta antibody is extensively used in research focused on understanding the mechanistic pathways of cellular regulation, and its disruptions may be linked to various diseases, including cancer and neurodegenerative disorders. This makes it a crucial tool for scientists investigating cell signaling pathways and developing potential therapeutic strategies targeting the 14-3-3 proteins.

FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.

BXDC1 antibody was raised in Rabbit using Human BXDC1 as the immunogen