
Acides aminés (AA)
Sous-catégories appartenant à la catégorie "Acides aminés (AA)"
- Dérivés d'acides aminés(4.017 produits)
- Acide aminé et composés apparentés aux acides aminés(3.490 produits)
- Acides aminés avec de l'oxygène ou du soufre(168 produits)
- Boc- Acides aminés(351 produits)
- Acides aminés avec groupes protecteurs(1.710 produits)
38384 produits trouvés pour "Acides aminés (AA)"
H-Ser-Met-OH
CAS :Glycyl-l-leucine is a muscle protein that belongs to the group of glycyl amino acids. It has been shown to have cortisone activity, which causes it to function as a suppressant. Glycyl-l-leucine binds to iron and prevents its oxidation, thereby preventing the formation of reactive oxygen species. Glycyl-l-leucine also has the ability to chelate iron, which can cause it to have antioxidant functions. The pH optimum for this compound is acidic and it is not active in neutral pH environments. This compound is found in fetal bovine serum and may be present in some food products such as chocolate milk or cheese. Glycyl-l-leucine may be used as an immobilizing agent for enzymes because it does not denature proteins at high concentrations.END>
Formule :C8H16N2O4SDegré de pureté :Min. 95%Masse moléculaire :236.29 g/molAc-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS :Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C104H146N24O23SDegré de pureté :Min. 95%Masse moléculaire :2,132.49 g/molAdrenomedullin (16-31) (human, pig)
CAS :Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C82H129N25O21S2Degré de pureté :Min. 95%Masse moléculaire :1,865.19 g/molMethyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate
CAS :Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H16N2O3SDegré de pureté :85%MinMasse moléculaire :292.35 g/molH-Lys-Pro-Tyr-OH acetate salt
CAS :Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H30N4O5Degré de pureté :Min. 95%Masse moléculaire :406.48 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C134H180N34O26S2Degré de pureté :Min. 95%Masse moléculaire :2,747.21 g/molRF9 trifluoroacetate salt
CAS :RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.Formule :C26H38N6O3Degré de pureté :Min. 95%Masse moléculaire :482.62 g/molCionin
CAS :Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.Formule :C53H63N11O19S3Degré de pureté :Min. 95%Masse moléculaire :1,254.33 g/molBoc-Gly-Gly-Leu-pNA
CAS :Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.Formule :C21H31N5O7Degré de pureté :Min. 95%Masse moléculaire :465.5 g/molDnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2
CAS :Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 is a protease that was isolated from the fungus Aspergillus niger. It has been shown to have high efficiency in cleaving peptide bonds, which makes it useful for protein sequencing and analysis. Dnp-Pro-Leu-Gly-Cys(Me)-His-Ala-D-Arg-NH2 can be used as an enzyme in the production of collagenase, a protein that breaks down collagen. This enzyme also has potential applications in the production of analogs for use in chromatography and sequencing techniques. The variable amino acids at positions 2, 3, 5, 6, 7, 9, 10, 11, 12 and 13 are important for activity and substrate specificity. The enzyme's activity is optimal under high pressure conditions and at pH 8.0. Dnp--Pro--Leu--Gly--Cys
Formule :C38H57N15O11SDegré de pureté :Min. 95%Masse moléculaire :932.02 g/molFmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh)
Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS :Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H226N40O46Degré de pureté :Min. 95%Masse moléculaire :3,313.63 g/molZ-Pro-Leu-Gly-OEt
CAS :Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le
Formule :C23H33N3O6Degré de pureté :Min. 95%Masse moléculaire :447.52 g/molMCH-Gene-Overprinted-Polypeptide-14 (rat)
CAS :Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H132N22O18S3Degré de pureté :Min. 95%Masse moléculaire :1,786.24 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS :N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats. The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.Formule :C7H12Cl2N2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :195.09 g/molACTH (7-38) (human)
CAS :ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.Formule :C167H257N47O46Degré de pureté :Min. 95%Masse moléculaire :3,659.12 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C134H207N41O36SDegré de pureté :Min. 95%Masse moléculaire :3,000.4 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS :Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C54H54NO8PSi2Degré de pureté :Min. 95%Masse moléculaire :932.15 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS :Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C162H254N50O36Degré de pureté :Min. 95%Masse moléculaire :3,478.07 g/molHepcidin-24 (human) trifluoroacetate salt
Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C109H165N33O28S9Degré de pureté :Min. 95%Masse moléculaire :2,674.28 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS :Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C32H56N4O6SDegré de pureté :Min. 95%Masse moléculaire :624.88 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS :Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C64H82N18O13Degré de pureté :Min. 95%Masse moléculaire :1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS :Intermediate in the synthesis of tedizolidFormule :C21H17FN6O2Degré de pureté :Min. 95%Masse moléculaire :404.4 g/molGRF (bovine) trifluoroacetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formule :C220H366N72O66SDegré de pureté :Min. 95%Masse moléculaire :5,107.77 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS :Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C28H43N10O12PDegré de pureté :Min. 95%Masse moléculaire :742.67 g/molUrocortin (human) trifluoroacetate salt
CAS :Trifluoroacetate saltFormule :C204H337N63O64Degré de pureté :Min. 95%Masse moléculaire :4,696.24 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS :Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H226N42O39Degré de pureté :Min. 95%Masse moléculaire :3,229.65 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS :Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C53H78N13O10S2Degré de pureté :Min. 95%Masse moléculaire :1,121.4 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS :Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C60H77N13O11Degré de pureté :Min. 95%Masse moléculaire :1,156.33 g/molBoc-His(1-Mts)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H27N3O6S·C12H23NDegré de pureté :Min. 95%Masse moléculaire :618.83 g/molH-Pro-Leu-Gly-Gly-OH
CAS :Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C15H26N4O5Degré de pureté :Min. 95%Masse moléculaire :342.39 g/mol4-Fluoro-2-methoxyaniline
CAS :4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.Formule :C7H8FNODegré de pureté :Min. 95%Couleur et forme :Light Brown To Brown LiquidMasse moléculaire :141.14 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS :Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C22H23NO4Degré de pureté :Min. 95%Masse moléculaire :365.42 g/molBoc-Phe-Merrifield resin (200-400 mesh)
Please enquire for more information about Boc-Phe-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-Met-D-Met-OH
CAS :Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C10H20N2O3S2Degré de pureté :Min. 95%Masse moléculaire :280.41 g/molN-Boc-isonipecotic acid
CAS :N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.Formule :C11H19NO4Degré de pureté :Min. 95%Masse moléculaire :229.27 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS :Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C112H176N38O22S3Degré de pureté :Min. 95%Masse moléculaire :2,503.04 g/molBoc-Pro-PAM resin (200-400 mesh)
Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Furin Inhibitor II trifluoroacetate salt
CAS :Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.Formule :C36H75N25O6Degré de pureté :Min. 95%Masse moléculaire :954.15 g/molH-Tyr-Lys-Thr-OH
CAS :Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C19H30N4O6Degré de pureté :Min. 95%Masse moléculaire :410.46 g/molZ-Glu-Gly-OH
CAS :Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.
Formule :C15H18N2O7Degré de pureté :Min. 95%Masse moléculaire :338.31 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS :Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C124H188N36O33SDegré de pureté :Min. 95%Masse moléculaire :2,743.11 g/mol3-Iodo-2-methylbenzoic acid
CAS :3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.Formule :C8H7IO2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :262.04 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS :The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.Formule :C96H123N19O22Degré de pureté :Min. 95%Masse moléculaire :1,895.12 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS :N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.Formule :C9H19NO3Degré de pureté :Min. 95%Couleur et forme :Colourless To Pale Yellow LiquidMasse moléculaire :189.25 g/molH-Lys(isopropyl)-OH
CAS :Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C9H20N2O2Degré de pureté :Min. 95%Masse moléculaire :188.27 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS :Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C21H30N6O5SDegré de pureté :Min. 95%Masse moléculaire :478.57 g/molZ-Ala-Phe-OMe
CAS :Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.Formule :C21H24N2O5Degré de pureté :Min. 95%Masse moléculaire :384.43 g/molFmoc-Ile-Ser(Psi(Me ,Me)pro)-OH
CAS :Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C27H32N2O6Degré de pureté :Min. 95%Masse moléculaire :480.55 g/molUrocortin II (mouse) trifluoroacetate salt
CAS :Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C187H320N56O50Degré de pureté :Min. 95%Masse moléculaire :4,152.89 g/mol
