Acides aminés (AA)

<p>Boc-glu(OtBu)-OH is a synthetic substrate that is used in chemical diversity studies. It has been shown to be an important model system for the study of disaccharide uptake and metabolism. This substrate binds to lectins, which are proteins found on the surface of cells. Boc-glu(OtBu)-OH binds to oligosaccharides and human cervical carcinoma cells, as well as amide groups. Analytical methods have been developed to measure its uptake and metabolism.</p>

<p>Fmoc-Gly-(Dmb)Gly-OH is a synthetic peptide that modulates cellular activity. It encompasses a wide range of activities, such as cancer cell growth and restenosis, fibroid tumors and bowel disease. Fmoc-Gly-(Dmb)Gly-OH has been shown to be an effective chemotherapeutic agent in the treatment of age-related macular degeneration and retinopathy. It also inhibits inflammatory bowel disease and infarction by restricting the production of inflammatory cytokines, such as TNFα, IL1β, and IL6. Fmoc-Gly-(Dmb)Gly-OH can be used to treat endometriosis by inhibiting angiogenesis in the uterus.</p>

<p>Please enquire for more information about FA-Arg-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Leu-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride is a chlorinated, thermosetting emulsifier that is used in the production of pressure sensitive adhesives. This compound has a high viscosity and is used as a retardant and an emulsifier. It is also used as a trichloride to produce vinyl chloride monomer. 3-(2,6-Dichlorophenyl)-5-methylisoxazole-4-carbonyl chloride inhibits the growth of bacteria by acting as an antimicrobial agent. The mechanism of action for this compound is not fully understood but it has been shown to inhibit protein synthesis in bacteria.</p>

<p>Please enquire for more information about H-Phe-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>Z-Tyr-Lys-Arg-pNA·2 TFA is a potent inhibitor of proteases. It has been shown to be an efficient inhibitor of the major yeast protease, proteinase A, and other enzymes that are used for the industrial production of peptides. Z-Tyr-Lys-Arg-pNA·2 TFA is a synthetic peptide with a molecular mass of 5,836 Da and an optimum pH of 7.5. This peptide is synthesized by the chemical reaction between butoxycarbonyl (Boc) Lys(Z)-Tyr(N)-Arg(R)-pNA and 2 equivalents of trifluoroacetic acid (TFA). The synthesis takes place in a homogenous solution in dichloromethane at room temperature in the presence of triethylamine as base. Filtration through a 0.22 μm filter removes any insoluble impurities from the solution.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-[D4]Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is a complex compound that is useful as a reagent for organic synthesis. It has been shown to be an effective intermediate in the synthesis of various compounds, such as peptides and pharmaceuticals. Fmoc-D-ApH(Cbm)-D-ApH(Cbm)-OH is also used as a building block for more complex molecules. This chemical has been shown to have high purity and quality, making it suitable for research purposes.</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyr-Gly-OH is a metabolite of the amino acid glutamate. It has been shown that this metabolite is formed by a non-enzymatic dehydration of glutamate. This compound has been shown to be effective in treating bowel disease and cancer, as well as stimulating the production of fibrinogen in the blood. Pyr-Gly-OH has also been found to have anti-inflammatory effects and an increased effect on glutamic receptors.</p>

<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycyl-l-leucine is a muscle protein that belongs to the group of glycyl amino acids. It has been shown to have cortisone activity, which causes it to function as a suppressant. Glycyl-l-leucine binds to iron and prevents its oxidation, thereby preventing the formation of reactive oxygen species. Glycyl-l-leucine also has the ability to chelate iron, which can cause it to have antioxidant functions. The pH optimum for this compound is acidic and it is not active in neutral pH environments. This compound is found in fetal bovine serum and may be present in some food products such as chocolate milk or cheese. Glycyl-l-leucine may be used as an immobilizing agent for enzymes because it does not denature proteins at high concentrations.END&gt;</p>

<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>

<p>Ac-Ala-Ala-Ala-Ala-OMe is a peptidase that hydrolyzes the ester bonds of the hydrophobic amino acid residues, such as alanine, valine, leucine, and isoleucine. This enzyme deacylates and releases these amino acids from the side chain of their corresponding fatty acyl groups. Ac-Ala-Ala-Ala-Ala-OMe also acts on N terminal and C terminal residues. The presence of a scissile bond in the peptide substrate is required for this enzyme to function. Acetylation reactions are concurrent with acylation reactions, which produce an acetylated peptide product.</p>

<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-14 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>

<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat:        H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>

<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>

<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>

<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>

<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>

<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>

<p>Please enquire for more information about H-Arg-Arg-4MbetaNA·3 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>

<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>

<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>