Peptides

<p>Peptide H-EVQLVQSGAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Magainin 2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SGYSGIFSVEGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>BMP 4 Human is a recombinant human protein that is a member of the TGF-β superfamily. It interacts with Ligand, Receptor, and Activator and has been shown to inhibit Ion channels in vitro. BMP 4 Human is a research tool for studying signaling pathways in pharmacology and cell biology.</p>

<p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-Qpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SRPTEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-TNQELQEINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YDIALVQEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AEDNADTLALVFEAPNQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TGTAEMSSILEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur and theses occurrences can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contribute to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.<br>One-Letter Formula: LSRFSWGAEGQRPGFGYGG</p>

<p>Peptide LCBiot-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HTDDEMTGYVATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-SGYSSPGSPGTPGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide LCBiot-PRIGGQRELKKITE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-AYPTPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5TAMRA-AMKRHGLDNYRGYSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VGRP^EWWMDYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-IYPTNGYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IYLDMLNVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Phe-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for peptide synthesis. It can be used in the synthesis of thiols, building blocks, alcohols and amines with 1% DVB.</p>

<p>H-Pro-His-Ser-Arg-Asn-OH is a synthetic peptide that binds to the α subunit of the nicotinic acetylcholine receptor. It is an inhibitor of the receptor and blocks the binding of acetylcholine to this receptor. H-Pro-His-Ser-Arg-Asn-OH has been used as a research tool in pharmacology, cell biology, and immunology.</p>

<p>Peptide Fluor-RGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLCGLLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is a peptide that was originally isolated from the venom of the Brazilian spider, Phoneutria nigriventer. This peptide has been shown to have anti tumor activity in mice by targeting and binding to the tumor cells. H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is also a cell penetrating peptide (CPP) that can penetrate into the cell and disrupts cancer cell growth. It is also a disulfide rich peptide with RGD sequence which binds to integrins on the surface of tumor cells and induces apoptosis.</p>

<p>Peptide H-AIWNVINWENVSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide TAMRA-QKRPSQRSKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Leu-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block for the synthesis of peptides. It may be used in the synthesis of amines, thiols, alcohols, and resin. This product can also be used as a tool for peptide synthesis.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Glu) is a peptide linker that is synthesized using solid phase synthesis. It has been shown to be cytotoxic to cancer cells in vitro and in vivo, with an IC50 of less than 15 μM in three different types of cancer cell lines. Cyclo(Arg-Gly-Asp-D-Phe-Glu) has a high uptake rate, which may be due to its ability to bind to the amino acid residue glutamic acid on the surface of cancer cells. This peptide also has a prognostic value for pancreatic cancer, as patients with increased levels of Cyclo(Arg-Gly-Asp-D-Phe-Glu) have a poorer prognosis.</p>

<p>HIF-1 alpha (556-574) is derived from hypoxia-inducible factor 1-alpha (HIF-1 alpha), a subunit of the heterodimeric transcription factor HIF-1 and is responsible for maintaining oxygen homeostasis. HIF-1 alpha is expressed under hypoxic conditions and is oxygen sensitive. Hypoxia can occur in cancer, heart disease and pulmonary disorders.Structurally HIF-1 alpha contains a N-terminal transactivation domain (N-TAD) which stabilises HIF-1 alpha and a C-terminal transactivation domain (C-TAD) which under hypoxic conditions regulates the transcription of HIF-1 alpha. Moreover HIF-1 alpha features an oxygen dependent degradation domain containing two proline residues and a lysine532. The two proline residues are substrates of prolyl-4-hydroxylases (PHDs) which in the presence of sufficient oxygen, are hydroxylated. Similarly the lysine residue is acetylated by arrest-defective-1 and this is reduced in hypoxic conditions. These hydroxylated prolines and acetylated lysine target HIF-1 alpha for ubiquitination and degradation.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

H-Phe-Leu-Leu-Arg-Asn-OH is a β-amino acid that has been shown to have antioxidant properties. It acts as a competitive inhibitor of the enzyme collagenase and has been shown to inhibit the development of atherosclerotic lesions in mice. The amide form of H-Phe-Leu-Leu-Arg-Asn has also been shown to have site specific activity on ventricular myocardium cells, which may be related to its ability to induce cytosolic calcium release. HPLR also has protease activity that can be inhibited by urea nitrogen and β amino acid. Basophilic leukemia cells produce HPLR at high levels and it is thought that this is due to an increased requirement for the production of collagen in these cells. HPLR has been shown to activate thrombin receptors, which are found on the surface of platelets and endothelial cells. Activated thrombin

<p>Peptide H-LKEFGNTLEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FAHTVVTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Bz-L-Arg-pNA • HCl is a protease inhibitor. It is a competitive inhibitor of bovine pancreatic trypsin, chymotrypsin, and elastase. Bz-L-Arg-pNA • HCl has also been shown to inhibit the growth of cancer cells in culture and to induce apoptosis. Bz-L-Arg-pNA • HCl binds to the active site of cathepsin and thiol proteases, inhibiting their activity by blocking peptide bond hydrolysis. This drug has been shown to inhibit proteolytic activation of proinflammatory cytokines such as IL1β, IL6, IL8, and TNFα.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-AVPYPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-TYLPAV^DEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Biot-GLLKLASPELERL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DSLFIPIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Phosphoramidon is a phosphonate compound that inhibits the binding of two enzymes, cholinesterase and butyrylcholinesterase. It has been shown to cause a bronchoconstrictor response in mice, inhibit mesenteric enzyme activities, and inhibit cardiac enzyme activity in rats. Phosphoramidon is used as an experimental drug for treatment of myocardial infarcts. It also has an effect on the central nervous system by acting on neurokinin-1 receptors and kappa-opioid receptors.<br>Phosphoramidon is a monosodium salt with biochemical properties similar to those of other members of this class of drugs.</p>

Peptide Biot-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Omega-Conotoxin MVIIC is a peptide that binds to the nicotinic acetylcholine receptor and activates it, leading to inhibition of neurotransmitter release. It is used as a research tool for studying the pharmacology of ion channels and their ligands. Omega-Conotoxin MVIIC is purified from Conus magus venom. The peptide has been shown to be an inhibitor of potassium channels in rat cortical neurons. CONOTOXINS are small peptides that bind to the nicotinic acetylcholine receptor and activate it, leading to inhibition of neurotransmitter release. They are used as research tools for studying the pharmacology of ion channels and their ligands. CONOTOXINS are purified from Conus magus venom. The peptide has been shown to be an inhibitor of potassium channels in rat cortical neurons.END&gt; END&gt;</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>BNP-45 is a peptide that binds to the beta-subunit of the Na+/K+ ATPase, inhibiting its activity. It is a potent inhibitor of the enzyme and has been used in research as a tool to study ion channels and receptor activation.<br> BNP-45 has been shown to inhibit ion-channel activity by binding to the beta subunit of the Na+/K+ ATPase. This inhibition leads to an increase in intracellular sodium and calcium levels, which may result in a variety of physiological effects.</p>

Peptide H-LPYGYGPGGVAGAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Boc-D-Leu-OH • H2O is an intramolecular hydrogen. It has a helical structure and forms hydrogen bonds with other molecules. Boc-D-Leu-OH • H2O is a cyclic peptide with a hydrophobic side chain and a hydrophilic head group. The peptide has been shown to have antimicrobial activity in the biliary and intestinal tract, as well as chronic pain relief properties. Boc-D-Leu-OH • H2O was found to be effective in animal studies for neuropathic pain, which may be due to its amide structure. A silico analysis revealed that the drug substance had a high binding affinity for the mu opioid receptor and could potentially be used to treat chronic pain caused by inflammation.</p>

<p>Peptide H-LLTSFLPAQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTVISVNPSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YQLAVTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KPNFIRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Octreotide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-TELLPGDRDNLAIQTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>H-ε-Aca-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block used in the synthesis of peptides. This resin has been designed to be compatible with amines, thiols, and alcohols, which are important for peptide synthesis. H-ε-Aca-2-ClTrt Resin (200-400 mesh) 1% DVB is an acid form of the amino acid Dde. It can be used for the preparation of solid phase peptide synthesis and for the purification of peptides after cleavage from the resin.</p>

<p>L-Leu-Leu-Glu-MCA is a research tool that activates the receptor. It is a ligand that binds to the receptor, activating it. L-Leu-Leu-Glu-MCA is a small molecule that has been shown to be an antagonist of ion channels in cell biology. It has been shown to inhibit protein interactions and peptide synthesis by inhibiting the binding of ATP. L-Leu-Leu-Glu-MCA also acts as an inhibitor of ion channels and high purity protein interactions, which may be due to its competitive inhibition of ATP binding. Ligands are used in pharmacology for studying protein interactions or inhibiting enzyme activity. The CAS No. for this compound is 348086-66-8.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

JAK3tide is a synthetic peptide, which is a highly specific substrate. Derived from comprehensive biochemical studies, it targets the catalytic activity of the Janus kinase 3 (JAK3) enzyme. JAK3tide's mode of action involves being phosphorylated by JAK3, an essential kinase involved in the signaling pathways of certain cytokines, making it a vital tool for assaying JAK3 activity.When used in in vitro kinase assays, it enables precise quantification of JAK3's enzymatic activity, which is pivotal for understanding pathway dynamics involved in immune responses. Its application extends to research areas focused on elucidating the mechanisms of immune signaling pathways and for the development of inhibitors as potential therapeutic agents in immunological disorders. JAK3tide provides a robust framework for scientists aiming to dissect the nuanced interactions within the JAK-STAT pathway and identify novel therapeutic targets, particularly in conditions where JAK3 is dysregulated.

<p>Peptide H-NIDALSGMEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SAPATGGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NTQPIMDTDGSYFVYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Boc-Asn-OH is a glycopeptide that has a basic structure. It is soluble in water and hydrochloric acid. Boc-Asn-OH has been shown to have antibacterial activity against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, as well as good solubility in organic solvents such as chloroform and acetonitrile. Preparative high performance liquid chromatography (HPLC) of Boc-Asn-OH reveals an amide, toxicity studies, proton, oligosaccharides, disulfide bond, thp-1 cells, conformational properties, esters hydrochloride.</p>

<p>Peptide H-HHIYLGAVNYIY-OH (Met-12 Peptide) is a Research Peptide with significant interest  as a small peptide Fas receptor agonist which as been used study inflammation responses. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Arg-Ala-Asp-Ser-Lys-OH is a peptide that is used in biochemistry research as a substrate for protease enzymes. It has the sequence H-Arg-Ala-Asp-Ser-Lys and is labeled with a fluorescent dye.</p>

<p>Peptide H-A^DQDNPWR^AYLDL^L^FPTDTLLLDLL^WCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SHTLYTHITPDAVPQLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-Rpt-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LEAEIATYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NQVVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SVLGQL^GITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>FA-Phe-Gly-Gly-OH is a peptide with angiotensin II inhibitory properties. It has been shown that FA-Phe-Gly-Gly-OH inhibits the enzyme activity of angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II, which causes blood vessel constriction. The inhibitory effects of FA-Phe-Gly-Gly-OH on ACE are reversible and competitive, which is different from other ACE inhibitors that are irreversible and noncompetitive. This peptide also has antioxidative properties, due to its ability to scavenge reactive oxygen species (ROS). This peptide can be hydrolysed by esterases or proteases in vitro or in vivo.</p>

<p>Peptide H-AFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Overlaping peptide library of Spike Omicron mutant. 15 amino acids per peptide with offset 11. Purity crude. All peptides are pooled in a single tube.</p>

<p>Peptide Ac-LVLRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGSVIDQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide LCBiot-RVTHHAFLGAHRTVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YSSDYFQAPSDYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-PEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-IQPTTPSEPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Ac-Lys-N-Me-Leu-Val-N-Me-Phe-Phe-NH2 is a peptide that has been shown to inhibit the formation of amyloid fibrils in Alzheimer's Disease. Ac-Lys-N-Me-Leu-Val-N-Me-Phe (KLVFF) is a biologically active peptide that is membrane permeable, allowing it to cross the blood brain barrier and enter the central nervous system. It inhibits the fibrillogenesis of amyloid beta protein, preventing it from aggregating into plaques.

<p>Z-Arg-Arg-AMC hydrochloride salt is a versatile compound that acts as a catalyst and forms strong hydrogen bonds. It exhibits proteolytic activity and has been found to be effective in breaking down proteins. In addition, Z-Arg-Arg-AMC hydrochloride salt has been shown to possess neuroprotective properties, making it a potential candidate for the treatment of neurological disorders. It also demonstrates anthelmintic activity, which means it can be used to combat parasitic worm infections. Furthermore, this compound has antioxidant activity and can help reduce lipid peroxidation, protecting cells from oxidative damage. With its diverse range of characteristics, Z-Arg-Arg-AMC hydrochloride salt holds great promise in various research fields such as biochemistry and medicine.</p>

Peptide H-GVSGLNAGNAASIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VAPEEHPTLLTEAPL^NPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.