Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29699 produits trouvés pour "Peptides"
[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formule :C40H72N12O13Masse moléculaire :929.09 g/molZ-Ile-Trp-OH
CAS :Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C25H29N3O5Degré de pureté :Min. 95%Masse moléculaire :451.51 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Formule :C123H195N31O39Masse moléculaire :2,732.04 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formule :C107H140N22O34S2Masse moléculaire :2,342.56 g/molDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formule :C75H114N24O19Masse moléculaire :1,655.89 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C180H287N57O48Masse moléculaire :4,017.55 g/molH-Thr-Asp-OH TFA salt
CAS :Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H14N2O6C2F3HO2Degré de pureté :Min. 95%Masse moléculaire :348.23 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formule :C133H204N34O37SMasse moléculaire :2,903.38 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/molα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Formule :C40H61N11O9Masse moléculaire :840.00 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formule :C93H159N35O25Masse moléculaire :2,167.52 g/mol[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Formule :C175H272N54O59S6Masse moléculaire :4,268.78 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formule :C45H82N14O13SMasse moléculaire :1,059.31 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formule :C76H113N25O18Masse moléculaire :1,664.90 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formule :C262H403N79O76S3Masse moléculaire :5,971.67 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formule :C124H205N39O39S2Masse moléculaire :2,930.38 g/molδ-Endorphin
Catalogue peptide; min. 95% purity
Formule :C83H131N19O27SMasse moléculaire :1,859.14 g/molTyr-Leptin (26-39) (human)
CAS :Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C23H33N5O9Masse moléculaire :523.55 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formule :C93H136N22O27Masse moléculaire :1,994.25 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formule :C72H103N19O16SMasse moléculaire :1,522.81 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formule :C52H84N14O21Masse moléculaire :1,241.33 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formule :C116H161N27O32S4Masse moléculaire :2,573.99 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formule :C64H99N19O17Masse moléculaire :1,406.62 g/molBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C32H48N8O14Masse moléculaire :768.78 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Formule :C119H204N34O32SMasse moléculaire :2,655.23 g/mol[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formule :C67H118N26O17Masse moléculaire :1,559.85 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Formule :C25H37N5O7Masse moléculaire :519.6 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formule :C23H28N4O4Masse moléculaire :424.50 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molHelodormin
Catalogue peptide; min. 95% purity
Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molIntermedin (human)
Catalogue peptide; min. 95% purity
Formule :C219H351N69O66S3Masse moléculaire :5,102.84 g/molFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formule :C41H59N11O9Masse moléculaire :850.00 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molAF-16 trifluoroacetate salt
CAS :AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formule :C71H119N25O25SDegré de pureté :Min. 95%Masse moléculaire :1,754.92 g/molRef: 3D-FA109941
Produit arrêté[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formule :C63H98N16O23S3Masse moléculaire :1,543.77 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formule :C45H59N11O8Masse moléculaire :882.04 g/molγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formule :C155H242N40O49SMasse moléculaire :3,481.96 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formule :C104H159N29O31Masse moléculaire :2,311.60 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C60H87N19O14Masse moléculaire :1,298.48 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS :Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C53H80N20O18Degré de pureté :Min. 95%Masse moléculaire :1,285.3 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS :Catalogue peptide; min. 95% purity
Formule :C121H193N33O30SMasse moléculaire :2,638.15 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formule :C44H66N14O10SMasse moléculaire :983.17 g/molBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C172H276N52O54S3Masse moléculaire :4,032.63 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formule :C137H212N42O39SMasse moléculaire :3,103.54 g/molabIII probe
Catalogue peptide; min. 95% purity
Formule :C87H115N23O24SMasse moléculaire :1,899.09 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formule :C28H36N6O6Masse moléculaire :552.64 g/molEndokinin A/B
Catalogue peptide; min. 95% purity
Formule :C50H77N13O12SMasse moléculaire :1,084.32 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formule :C63H103N25O19Masse moléculaire :1,514.68 g/molBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molSaposin C18
Catalogue peptide; min. 95% purity
Formule :C93H164N24O31Masse moléculaire :2,114.49 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formule :C79H116N22O17Masse moléculaire :1,645.9 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formule :C149H224N44O45SMasse moléculaire :3,383.78 g/molα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formule :C44H67N13O9Masse moléculaire :922.11 g/molInfluenza A NP (366-374)
Catalogue peptide; min. 95% purity
Formule :C36H59N11O17S2Masse moléculaire :982.06 g/molBax-BH3L63A
Catalogue peptide; min. 95% purity
Formule :C74H129N22O27SMasse moléculaire :1,791.05 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formule :C135H221N45O33Masse moléculaire :3,002.55 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Formule :C47H85N14O13SMasse moléculaire :1,087.35 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H24N2O6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :497.67 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS :Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H32N4O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :392.49 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molH-Ala-Abu-OH
CAS :Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H14N2O3Degré de pureté :Min. 90%Couleur et forme :PowderMasse moléculaire :174.2 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formule :C35H56N8O9SMasse moléculaire :765 g/molH-Asp-NH2
CAS :H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formule :C4H8N2O3Degré de pureté :Min. 95%Masse moléculaire :132.12 g/molRef: 3D-FA107876
Produit arrêtéAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS :Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H63N15O13Degré de pureté :Min. 95%Masse moléculaire :1,082.13 g/molDisulfide biotin azide
CAS :Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formule :C27H48N8O7S3Degré de pureté :Min 95%Masse moléculaire :692.92 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formule :C65H116N16O17Masse moléculaire :1,393.75 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formule :C61H94N18O16Masse moléculaire :1,335.5 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
