Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29780 produits trouvés pour "Peptides"
Dok-6 (263-275)
Catalogue peptide; min. 95% purity
Formule :C76H113N25O18Masse moléculaire :1,664.90 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formule :C44H62N10O10S2Masse moléculaire :955.17 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formule :C65H116N16O17Masse moléculaire :1,393.75 g/molAc-Endothelin-1 (16-21), human
Catalogue peptide; min. 95% purity
Formule :C41H59N9O10Masse moléculaire :837.98 g/molGLP-2 (rat)
Catalogue peptide; min. 95% purity
Formule :C166H256N44O56SMasse moléculaire :3,796.22 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
beta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molDisulfide biotin azide
CAS :Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formule :C27H48N8O7S3Degré de pureté :Min 95%Masse moléculaire :692.92 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Formule :C58H77N13O10Masse moléculaire :1,116.34 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molbeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formule :C86H151N31O26S2Masse moléculaire :2,099.48 g/molAlpha-Dendrotoxin
CAS :Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Formule :C305H472N98O84S6Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :7,048.02 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H24N2O6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :497.67 g/molBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C172H276N52O54S3Masse moléculaire :4,032.63 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formule :C51H76N16O21SMasse moléculaire :1,269.31 g/molC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formule :C23H40N6O10Masse moléculaire :560.61 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formule :C96H156N34O31SMasse moléculaire :2,314.59 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formule :C163H239N45O51S2Masse moléculaire :3,709.03 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C216H343N67O60Masse moléculaire :4,838.43 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formule :C194H296N54O57SMasse moléculaire :4,328.91 g/molγ-Bag Cell Peptide
Catalogue peptide; min. 95% purity
Formule :C31H51N11O8Masse moléculaire :705.82 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formule :C42H61N11O10Masse moléculaire :880.02 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formule :C135H221N45O33Masse moléculaire :3,002.55 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formule :C66H102N20O13Masse moléculaire :1,383.68 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formule :C194H318N62O62SMasse moléculaire :4,543.14 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formule :C167H258N46O48SMasse moléculaire :3,710.26 g/mol[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formule :C67H112N16O25Masse moléculaire :1,541.73 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formule :C170H253N47O52Masse moléculaire :3,787.20 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formule :C93H136N22O27Masse moléculaire :1,994.25 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formule :C70H101N21O18Masse moléculaire :1,524.72 g/mol[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Formule :C78H109N23O15SMasse moléculaire :1,640.95 g/molγ-TAC4 (32-50)
Catalogue peptide; min. 95% purity
Formule :C92H146N24O31Masse moléculaire :2,084.33 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
Catalogue peptide; min. 95% purity
Formule :C46H71N15O11SMasse moléculaire :1,042.24 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formule :C28H36N6O6Masse moléculaire :552.64 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formule :C137H212N42O39SMasse moléculaire :3,103.54 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C43H47FN4O15Degré de pureté :Min. 95%Masse moléculaire :878.85 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C74H114N28O20Masse moléculaire :1,715.91 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C101H172N30O32Masse moléculaire :2,318.66 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formule :C72H110N19O33Masse moléculaire :1,862.77 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formule :C59H91N11O15Masse moléculaire :1,194.45 g/molAmylin (human) trifluoroacetate salt
CAS :Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formule :C165H261N51O55S2Degré de pureté :Min. 95%Masse moléculaire :3,903.28 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/molTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Formule :C51H91N19O18Masse moléculaire :1,258.41 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formule :C157H253N53O42Masse moléculaire :3,555.01 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formule :C99H153N29O26S5Masse moléculaire :2,325.82 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formule :C44H67N15O13S2Masse moléculaire :1,078.25 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formule :C72H107N19O24Masse moléculaire :1,622.77 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H243N41O31Masse moléculaire :3,080.83 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formule :C130H221N37O35SMasse moléculaire :2,894.43 g/molHelodormin
Catalogue peptide; min. 95% purity
Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molH-Asp-beta-Ala-OH
CAS :Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H12N2O5Degré de pureté :Min. 90 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molH-D-Phe-pip-Arg-pna acetate
CAS :H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formule :C27H36N8O5Degré de pureté :Min. 95%Masse moléculaire :552.6 g/molRef: 3D-QEA38896
Produit arrêtéAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formule :C79H116N22O17Masse moléculaire :1,645.9 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Met5,Arg6,7,Val8,Gly9] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00877.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
