Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29780 produits trouvés pour "Peptides"
Vasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formule :C116H161N27O32S4Masse moléculaire :2,573.99 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formule :C63H103N25O19Masse moléculaire :1,514.68 g/molMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formule :C50H69N15O9Masse moléculaire :1,024.2 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formule :C82H122N22O25SMasse moléculaire :1,848.08 g/molHuman CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Formule :C52H96N20O16Masse moléculaire :1,257.47 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formule :C74H128N16O18Masse moléculaire :1,529.95 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formule :C59H82N14O18Masse moléculaire :1,275.4 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C60H87N19O14Masse moléculaire :1,298.48 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formule :C90H136N22O28S2Masse moléculaire :2,038.34 g/molPrepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formule :C118H182N32O32Masse moléculaire :2,560.96 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molbeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formule :C190H288N54O57Masse moléculaire :4,240.64 g/molgp100 (570-579)
Catalogue peptide; min. 95% purity
Formule :C41H71N11O17Masse moléculaire :990.09 g/molgp100 (178-187)
Catalogue peptide; min. 95% purity
Formule :C42H71N11O14S2Masse moléculaire :1,018.23 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Formule :C74H121N17O20SMasse moléculaire :1,600.9 g/mol[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formule :C67H112N16O25Masse moléculaire :1,541.73 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formule :C44H66N14O10SMasse moléculaire :983.17 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C216H343N67O60Masse moléculaire :4,838.43 g/mol[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formule :C67H118N26O17Masse moléculaire :1,559.85 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formule :C45H59N11O8Masse moléculaire :882.04 g/molγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formule :C155H242N40O49SMasse moléculaire :3,481.96 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formule :C46H68N10O14SMasse moléculaire :1,017.17 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formule :C93H136N22O27Masse moléculaire :1,994.25 g/mol[Tyr1]-pTH (1-34) (rat)
Catalogue peptide; min. 95% purity
Formule :C186H295N55O49S2Masse moléculaire :4,149.86 g/molCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formule :C114H175N25O42S2Masse moléculaire :2,631.93 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formule :C52H74N20O15S4Masse moléculaire :1,347.58 g/molBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formule :C157H252N46O44S2Masse moléculaire :3,552.17 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formule :C65H109N17O19SMasse moléculaire :1,464.75 g/molbeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Formule :C56H76N16O22Masse moléculaire :1,325.32 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formule :C40H72N12O13Masse moléculaire :929.09 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formule :C42H61N11O10Masse moléculaire :880.02 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C32H48N8O14Masse moléculaire :768.78 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formule :C47H72N14O11Masse moléculaire :1,009.19 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formule :C35H51N9O8Masse moléculaire :725.85 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formule :C194H318N62O62SMasse moléculaire :4,543.14 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formule :C48H86N18O16Masse moléculaire :1,171.33 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formule :C46H75N9O11S2Masse moléculaire :994.28 g/molDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formule :C75H114N24O19Masse moléculaire :1,655.89 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formule :C217H322N58O60SMasse moléculaire :4,767.47 g/molTyr-Leptin (26-39) (human)
CAS :Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formule :C39H68N16O11Masse moléculaire :937.08 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formule :C147H227N39O43SMasse moléculaire :3,260.75 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formule :C124H205N39O39S2Masse moléculaire :2,930.38 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Biotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molabIII probe
Catalogue peptide; min. 95% purity
Formule :C87H115N23O24SMasse moléculaire :1,899.09 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Formule :C157H261N49O43S6Masse moléculaire :3,715.47 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formule :C65H116N16O17Masse moléculaire :1,393.75 g/mol[Arg3] Substance P
Catalogue peptide; min. 95% purity
Formule :C63H98N20O13SMasse moléculaire :1,375.67 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formule :C194H296N54O57SMasse moléculaire :4,328.91 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formule :C130H221N37O35SMasse moléculaire :2,894.43 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formule :C133H204N34O37SMasse moléculaire :2,903.38 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formule :C104H159N29O31Masse moléculaire :2,311.60 g/molSaposin C18
Catalogue peptide; min. 95% purity
Formule :C93H164N24O31Masse moléculaire :2,114.49 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formule :C262H403N79O76S3Masse moléculaire :5,971.67 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molZ-Asp-Gln-Met-Asp-AFC
CAS :Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C36H39F3N6O13SDegré de pureté :Min. 95%Masse moléculaire :852.79 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C23H33N5O9Masse moléculaire :523.55 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
