Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29860 produits trouvés pour "Peptides"
[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formule :C64H99N19O17Masse moléculaire :1,406.62 g/molIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Degré de pureté :Min 85% By Sds-Page.Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formule :C39H68N16O11Masse moléculaire :937.08 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formule :C194H296N54O57SMasse moléculaire :4,328.91 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formule :C171H271N51O54S2Masse moléculaire :3,969.50 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formule :C42H61N11O10Masse moléculaire :880.02 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formule :C40H72N12O13Masse moléculaire :929.09 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formule :C124H205N39O39S2Masse moléculaire :2,930.38 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formule :C72H110N19O33Masse moléculaire :1,862.77 g/molHelodormin
Catalogue peptide; min. 95% purity
Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formule :C48H86N18O16Masse moléculaire :1,171.33 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formule :C112H197N39O30Masse moléculaire :2,570 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formule :C44H67N15O13S2Masse moléculaire :1,078.25 g/molH-Thr-Asp-OH TFA salt
CAS :Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H14N2O6C2F3HO2Degré de pureté :Min. 95%Masse moléculaire :348.23 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formule :C72H107N19O24Masse moléculaire :1,622.77 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C41H43FN4O14Degré de pureté :Min. 95%Masse moléculaire :834.8 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formule :C99H153N29O26S5Masse moléculaire :2,325.82 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formule :C116H190N32O35SMasse moléculaire :2,625 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formule :C73H117N19O19Masse moléculaire :1,564.86 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molMBP (90-106)
Catalogue peptide; min. 95% purity
Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formule :C34H50N8O6SMasse moléculaire :698.9 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formule :C15H28N4O5Masse moléculaire :344.41 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formule :C59H104N22O20Masse moléculaire :1,441.62 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formule :C163H239N45O51S2Masse moléculaire :3,709.03 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formule :C44H66N14O10SMasse moléculaire :983.17 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formule :C59H89N17O14Masse moléculaire :1,260.47 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formule :C114H174N30O42SMasse moléculaire :2,668.90 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formule :C79H116N22O17Masse moléculaire :1,645.9 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formule :C70H101N21O18Masse moléculaire :1,524.72 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/molHead activator
Catalogue peptide; min. 95% purity
Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formule :C59H91N11O15Masse moléculaire :1,194.45 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
