Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30473 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-DSGSPNPAR-OH
<p>Peptide H-DSGSPNPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPIVQYDNF-OH
<p>Peptide H-KPIVQYDNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLHVMHKVAPPRGGGC-OH
<p>Peptide H-GLHVMHKVAPPRGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPRKPIKCW-OH
<p>Peptide H-GPRKPIKCW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSLSYR-OH
<p>Peptide H-VSLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIQTAVR-OH
<p>Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLSESQVK-OH
<p>Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TRFASVYAW-OH
<p>Peptide H-TRFASVYAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSTGSIDMVD-OH
<p>Peptide H-CSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MEVDPIGHLY-OH
<p>Peptide H-MEVDPIGHLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C53H80N12O16SMasse moléculaire :1,173.35 g/molH-GCTVHG-OH
<p>Peptide H-GCTVHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
<p>H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C203H311N55O60SMasse moléculaire :4,514.1 g/molH-VYVHPF-OH
<p>Peptide H-VYVHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RMPEAAPPV-OH
<p>Peptide H-RMPEAAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IALTNSVNEALLNPSR-OH
<p>Peptide H-IALTNSVNEALLNPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TWSKVGGHLRPGIVQSG-OH
<p>Peptide H-TWSKVGGHLRPGIVQSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGSGLVGR-OH
<p>Peptide H-SGSGLVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFSWASVTSK-OH
<p>Peptide H-TFSWASVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GERIVDII-OH
<p>Peptide H-GERIVDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IALYLQQNW-OH
<p>Peptide H-IALYLQQNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C55H81N13O14Masse moléculaire :1,148.32 g/molH-AFDQIDNAPEEK-OH
<p>Peptide H-AFDQIDNAPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HP-OH
<p>Peptide H-HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFRHDSC-OH
<p>Peptide H-EFRHDSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNYMYAR-OH
<p>Peptide H-NNYMYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAIPTNFTI-OH
<p>Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPFA-OH
<p>Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTFASLSELHCDK-OH
<p>Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLKDAIKDL-OH
<p>Peptide H-VLKDAIKDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QEEEEDEDEER-OH
<p>Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
<p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C194H295N55O57Masse moléculaire :4,309.81 g/molH-FNLAGNHEQEFLR-OH
<p>Peptide H-FNLAGNHEQEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEITPYKPTW-OH
<p>Peptide H-VEITPYKPTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYVQALLR-OH
<p>Peptide H-FYVQALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
<p>H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TYTSGEACL-OH
<p>Peptide H-TYTSGEACL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAVP-OH
<p>Peptide H-FAVP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLDALQAIK-OH
<p>Peptide H-VLDALQAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDSIICVK-OH
<p>Peptide H-LDSIICVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARYAYYLQF-OH
<p>Peptide H-ARYAYYLQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTNFPICIFCCKCCNNSQCGICCKT-OH
<p>H-DTNFPICIFCCKCCNNSQCGICCKT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-ITFPGLHEL-OH
<p>Peptide H-ITFPGLHEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APRGPHGGAASGL-OH
<p>Peptide H-APRGPHGGAASGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRLSYSRRRF-OH
<p>Peptide H-RRLSYSRRRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PPGNYIGERPY-OH
<p>Peptide H-PPGNYIGERPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTITSGWTF-OH
<p>Peptide H-GTITSGWTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALYLVCGER-OH
<p>Peptide H-EALYLVCGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPIGAGICASY-OH
<p>Peptide H-IPIGAGICASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVDVPDGRGDSLAYG-OH
<p>Peptide H-DVDVPDGRGDSLAYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETTIQGLDGLSER-OH
<p>Peptide H-ETTIQGLDGLSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPSYVYHQF-OH
<p>Peptide H-SPSYVYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIYKRWIILGLNKIVRMY-OH
<p>Peptide H-EIYKRWIILGLNKIVRMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STKKLSECEKRIGDELDSNM-OH
<p>H-STKKLSECEKRIGDELDSNM-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-QEPSQGTTTFAVTSILR-OH
<p>Peptide H-QEPSQGTTTFAVTSILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-INITRFQTL-OH
<p>Peptide H-INITRFQTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLELTSDNDR-OH
<p>Peptide H-VLELTSDNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDALHMQALPPR-OH
<p>Peptide H-YDALHMQALPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH
<p>Peptide H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFRHDSGY-NH2
<p>Peptide H-EFRHDSGY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PKEK-OH
<p>Peptide H-PKEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C22H40N6O7Masse moléculaire :500.6 g/molH-RKIYDLIEL-OH
<p>Peptide H-RKIYDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPFPIIV-OH
<p>Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSKKPVPIIYCNRRTGKCQRM-OH
<p>Peptide H-GSKKPVPIIYCNRRTGKCQRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYFPHFDVSHGSAQVK-OH
<p>Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CASDAKAYDTEVHNV-OH
<p>H-CASDAKAYDTEVHNV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TEAFIPFSLGK-OH
<p>Peptide H-TEAFIPFSLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLKLTPLL-OH
<p>Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CFFQNCPKG-NH2
CAS :<p>H-CFFQNCPKG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C46H65N13O11S2Masse moléculaire :1,040.23 g/molH-IVGGWECEK-OH
<p>Peptide H-IVGGWECEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KMLKEMGEV-OH
<p>Peptide H-KMLKEMGEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RERQR-OH
<p>Peptide H-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KHFGKDSNFPFGT-OH
<p>H-KHFGKDSNFPFGT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-LHGGSPWPPCQYR-OH
<p>Peptide H-LHGGSPWPPCQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFDSFGDLSSASAIMGNAK-OH
<p>Peptide H-YFDSFGDLSSASAIMGNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLWEWASVR-OH
<p>Peptide H-YLWEWASVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
<p>H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C192H295N61O60SMasse moléculaire :4,449.9 g/molH-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
<p>H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C145H240N44O48S2Masse moléculaire :3,431.9 g/molH-GQAEPDRAHYNIVTF-OH
<p>Peptide H-GQAEPDRAHYNIVTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLFRAVITK-OH
<p>Peptide H-SLFRAVITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPETER-OH
<p>Peptide H-TPETER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYQSIR-OH
<p>Peptide H-WYQSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
<p>H-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-GESA-OH
<p>Peptide H-GESA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLTFGRETV-OH
<p>Peptide H-CLTFGRETV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQTSQDAR-OH
<p>Peptide H-GLQTSQDAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPEQTQGNFGDQELIR-OH
<p>Peptide H-GPEQTQGNFGDQELIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSSNYCCELCCNPACTGCY-OH
CAS :<p>H-NSSNYCCELCCNPACTGCY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C79H112N22O30S6Masse moléculaire :2,042.28 g/molH-GLFRALLRLLRSLWRLLLRA-NH2
<p>Peptide H-GLFRALLRLLRSLWRLLLRA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QRSYVSGVL-OH
<p>Peptide H-QRSYVSGVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRGKWQRRYR-OH
<p>Peptide H-LRGKWQRRYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFPDLESEF-OH
<p>Peptide H-TFPDLESEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASQSVSSYLAWYQQK-OH
<p>Peptide H-ASQSVSSYLAWYQQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVVVGACGV-OH
<p>H-KLVVVGACGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C42H77N11O11S1Masse moléculaire :944.2 g/molH-RRWIQLGLQK-OH
<p>Peptide H-RRWIQLGLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGGRLSYSRRRFSTSTGR-OH
<p>Peptide H-RGGRLSYSRRRFSTSTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VRIGHLYIL-OH
<p>Peptide H-VRIGHLYIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLNFFTK-OH
<p>Peptide H-YLNFFTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPTPNVSVVDLTCR-OH
<p>Peptide H-VPTPNVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGESAEFVCK-OH
<p>Peptide H-TGESAEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
