Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30355 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-IAIPTNFTI-OH
Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFA-OH
Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLKDAIKDL-OH
<p>Peptide H-VLKDAIKDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SELTQQLNALFQDK-OH
<p>Peptide H-SELTQQLNALFQDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QEEEEDEDEER-OH
<p>Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQSENFEYVAFK-OH
<p>Peptide H-SQSENFEYVAFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
<p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C194H295N55O57Masse moléculaire :4,309.81 g/molH-FNLAGNHEQEFLR-OH
<p>Peptide H-FNLAGNHEQEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEITPYKPTW-OH
Peptide H-VEITPYKPTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPP-OH
<p>Peptide H-PPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRRGQILWFRGLNRIQTQIK-OH
CAS :<p>Peptide H-LRRGQILWFRGLNRIQTQIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C113H190N38O26Masse moléculaire :2,497 g/molH-AAAAAAAAAAAAA-OH
<p>H-AAAAAAAAAAAAA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-KSWMESEF-OH
<p>Peptide H-KSWMESEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGEALYE-OH
<p>Peptide H-AGEALYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIVGAVLK-OH
<p>Peptide H-DIVGAVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STTVKAACWW-OH
<p>Peptide H-STTVKAACWW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIEAPSTNG-OH
<p>Peptide H-AIEAPSTNG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KDPNYDERSE-OH
<p>Peptide H-KDPNYDERSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRRRRRRRR-OH
<p>Peptide H-CRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLGEFLKLDRERAKN-OH
Peptide H-TLGEFLKLDRERAKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLDTLTAFY-OH
<p>Peptide H-TLDTLTAFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TESTT-OH
Peptide H-TESTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RAHYNIVTFCCKCDS-OH
<p>Peptide H-RAHYNIVTFCCKCDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ACTGSTQHQCG-NH2
<p>Peptide ACTGSTQHQCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C40H63N15O17S2Masse moléculaire :1,090.16 g/molH-LPFNDGVYF-OH
Peptide H-LPFNDGVYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDLER-OH
Peptide H-LDLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSRLPFGMA-OH
<p>Peptide H-LSRLPFGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KELYPLTSL-OH
<p>Peptide H-KELYPLTSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPTLHEYML-OH
Peptide H-TPTLHEYML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGEKG-OH
<p>Peptide H-MGEKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVLEGGIDPILR-OH
Peptide H-VVLEGGIDPILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTNPVQLDDFD-NH2
Peptide H-CTNPVQLDDFD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPAINVNDSVTK-OH
Peptide H-VPAINVNDSVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVIPCGESCVFIPCISTLLGCSCKNKVCYRN-OH
<p>H-GVIPCGESCVFIPCISTLLGCSCKNKVCYRN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-HPVGDADYFEY-OH
<p>Peptide H-HPVGDADYFEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPVAEADYFEY-OH
<p>Peptide H-HPVAEADYFEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLRRSSCFGGRMDRIGAQSGLGCNSFRYRITAREDKQGWA-OH
<p>H-SLRRSSCFGGRMDRIGAQSGLGCNSFRYRITAREDKQGWA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-IDIDID-OH
<p>Peptide H-IDIDID-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQTHIFAEV-OH
<p>Peptide H-LQTHIFAEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYGPVFMSL-OH
<p>Peptide H-TYGPVFMSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
<p>Peptide H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALYLVCGE-OH
<p>Peptide H-ALYLVCGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPVGEADYF-OH
Peptide H-HPVGEADYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLSAWILTA-OH
<p>Peptide H-LLSAWILTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAAAAAAAAA-OH
Peptide H-AAAAAAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALWKTLLKKVLKA-NH2
<p>Peptide H-ALWKTLLKKVLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH
<p>H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-GLFGAIAGFI-OH
<p>Peptide H-GLFGAIAGFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIAQDFK-OH
<p>Peptide H-EIAQDFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSKGCFGLKLDRIGSMSGLGC-OH
<p>H-GLSKGCFGLKLDRIGSMSGLGC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-LKYWWNLLQYWSQEL-OH
H-LKYWWNLLQYWSQEL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-APQPAPENAY-OH
Peptide H-APQPAPENAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVFGIELMEV-OH
<p>Peptide H-LVFGIELMEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGGVGKSA-OH
Peptide H-GAGGVGKSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITTQQWLIK-OH
Peptide H-LITTQQWLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASSTLYLVF-OH
<p>Peptide H-ASSTLYLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKRWIILGLNKIVRMYS-OH
<p>Peptide H-YKRWIILGLNKIVRMYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KVK-OH
Please enquire for more information about H-KVK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-VYYDPSKDLIA-OH
<p>Peptide H-VYYDPSKDLIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLVPIVATV-OH
<p>Peptide H-NLVPIVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KVK-OH
<p>Please enquire for more information about H-KVK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-KVK-OH
<p>Please enquire for more information about H-KVK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-PKEK-OH
Please enquire for more information about H-PKEK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-PKEK-OH
Please enquire for more information about H-PKEK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-QDVH-OH
<p>Please enquire for more information about H-QDVH-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-PKEK-OH
Please enquire for more information about H-PKEK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-SENDRLRLL-OH
Peptide H-SENDRLRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLYRLFRKSNLKPFE-OH
Peptide H-YLYRLFRKSNLKPFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAPVAIPQ-OH
<p>Peptide H-NAPVAIPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNEKDYELLCLDGTR-OH
<p>Peptide H-NLNEKDYELLCLDGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RTVPSGPDPLHH-OH
<p>Peptide H-RTVPSGPDPLHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQVTNSATI-OH
<p>Peptide H-SQVTNSATI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>3-Amino-2-naphthoic Acid
CAS :Formule :C11H9NO2Degré de pureté :>97.0%(T)Couleur et forme :Light yellow to Amber to Dark green powder to crystalMasse moléculaire :187.20H-YTDVSNMSHLA-OH
<p>Peptide H-YTDVSNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLLLLLLLLLKKK-NH2
<p>Peptide H-LLLLLLLLLLKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS :<p>H-HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C148H223N39O46Masse moléculaire :3,284.63 g/molH-SLMDLLSSL-OH
Peptide H-SLMDLLSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSPAEDSKSKEGSQNPQSQ-OH
<p>Peptide H-CSPAEDSKSKEGSQNPQSQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GRGES-OH
<p>Peptide H-GRGES-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEQNTLQEFLK-OH
<p>H-AVEQNTLQEFLK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formule :C63H102N16O21Masse moléculaire :1,419.6 g/molH-NVDLSTFYQNR-OH
<p>Peptide H-NVDLSTFYQNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVCGGIMFL-OH
<p>Peptide H-TVCGGIMFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WVDGTDYETGFK-OH
<p>Peptide H-WVDGTDYETGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEGGVGWRHW-OH
Peptide H-AEGGVGWRHW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIHDIILEC-OH
Peptide H-TIHDIILEC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGVSCEVIDLR-OH
<p>Peptide H-LGVSCEVIDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGRYDEYRGCSPDGYGG-OH
<p>Peptide H-GGRYDEYRGCSPDGYGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLDV-OH
<p>Peptide H-DLDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNFNFNGL-OH
<p>Peptide H-VNFNFNGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYSAGIVQI-OH
Peptide H-TYSAGIVQI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MSCCRSSRTRRETQL-OH
<p>Peptide H-MSCCRSSRTRRETQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-REPVTKAEML-OH
<p>Peptide H-REPVTKAEML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KNKESKDPADETEAD-OH
<p>H-KNKESKDPADETEAD-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-ILGFVFTLTV-OH
<p>Peptide H-ILGFVFTLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIYRQPNCDDPETEEAALVAIDYIAPHGPG-OH
Peptide H-LIYRQPNCDDPETEEAALVAIDYIAPHGPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNSAAFPAPIEK-OH
<p>Peptide H-VNSAAFPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIRLRPGGKKKY-OH
Peptide H-KIRLRPGGKKKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPYF-OH
Peptide H-EPYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YIIFVYIPL-OH
<p>Peptide H-YIIFVYIPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
