Peptides

Cyclic DAG peptide targets connective tissue growth factor (CTGF/CCN2), present in the extracellular matrix, endothelial cells and overexpressed in several brain diseases. CTGF is a matricellular protein that acts as a regulator of several cellular functions, including cell adhesion, migration, mitogenesis, differentiation, and survival. CTGF is up regulated in Alzheimer's disease, Parkinson's disease, brain injury, glioblastoma, and cerebral infarction.DAG peptide has been shown to home to the brain in mouse models of glioblastoma, traumatic brain injury, and Parkinson's disease when exogenously delivered, making it an attractive target for the treatment of glioblastoma. DAG may be of use as a tool to enhance delivery of therapeutics and imaging agents to sites of brain diseases.

Auto-inducing peptide (AIP) is a cyclic thiolactone quorum sensing peptide from Staphylococcus aureus which is responsible for activating the agr response. AIP is released from the bacteria and its extracellular concentration is then sensed by a two-component system on the bacterial surface, AgrC and AgrA. AgrC is the membrane histidine kinase receptor and AgrA is a response regulator- upon binding of AIP, AgrC phosphorylates AgrA.AIP accumulates during growth activating an AgrC and AgrA cascade when it reaches a critical signal level. This cascade activates P2 and P3 promoters which autoactivate the agr system and upregulate RNAIII transcription. RNAIII regulates the expression of virulence factors including toxins, super-antigens, and exo-enzymes. Extensive research to identify AIP:AgrC inhibitors aims to find therapeutics against pathogens.AgrD is the precursor peptide of AIP, and AgrB is an integral membrane endopeptidase essential to biosynthesize AIP. This AIP system is conserved among many Gram-positive bacteria. S. aureus strains are categorized into four groups (I-IV) according to their AIP signal and cognate extracellular receptor, AgrC.  AIP-I has the characteristic five-residue thiolactone ring with a short N-terminal extension. AIP-I has been used to generate a biosensor for the detection of S. aureus in nanomolar range for use in hospital settings.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Venom peptidomes and proteomes have yielded significant novel drug discoveries. The non-disulphide bridge peptides (NDBPs) have become a particular focus due to their large range of structures as well biological activity while retaining high specificity.AcrAP2 was identified as a NDBP in A. crassicauda within highly conserved family of proteins. Data shows it has antimicrobial activity against bacteria and yeast while also capable of haemolysing horse erythrocytes. However, AcrAP2 did not affect the growth of cancerous cell lines tested. Therefore, this peptide could be a useful model for modification to improve its potency. Furthermore, it may allow researchers to identify specific targets in disease pathways for new drug designs. A significant example of this, bradykinin-potentiating peptide Captopril® manages hypertension and originated from the conserved NDBP family.

Peptide LCBiot-DWEYSVWLSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AAVENLPTFLVELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EGVVAAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

The LDVP peptide (CS1), located in the type III connecting segment (V-region) of fibronectin, exhibits cell binding properties thus contributing to the adhesion of fibronectin to other cells.

Proinsulin connecting peptide (C-peptide), links the A and B chains of proinsulin. Upon enzymatic cleavage of C-peptide from pro-insulin in the pancreas, C-peptide is released into the blood stream along with insulin (A- and B-chains bonded together) in equimolar quantities. C-peptide can influence a wide variety of physiological conditions linked to diabetes, such as neuropathy, nephropathy, and encephalopathy. C-peptide is able to ameliorate and reverse the degrading effects of neuropathy in diabetes.

Peptide H-K^DMQLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Galanin is a widely distributed neuropeptide in the central nervous system (CNS), peripheral regions and endocrine system. Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy. A better understanding of the galinergic signalling pathways may uncover a source for therapeutics for conditions such as epilepsy.Unlike human galanin, full-length porcine galanin contains only 29 amino acids and is C-terminally amidated. The first 15 residues are still highly conserved.  The best-recognized effect of galanin on the endocrine pancreas is the inhibition of insulin secretion in vitro and in vivo on multiple model systems, including rats, dogs, and mice. However, the same effect cannot be achieved at the same concentrations in human models with infusions of porcine galanin. Structural activity and point mutation studies show that the N-terminal (1-15) fragment is vital for the interaction/activation of the GAL receptor and the inhibition of insulin secretion.

Peptide H-EALQGVGDMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ANEILASVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-2 agonist peptide represents the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis.This peptide has been shown to elicit a range of cellular responses including- histamine release from skin mast cells- IL-8 and lactoferrin secretion from peripheral blood neutrophils- increased vascular cell adhesion molecule-1 (VCAM-1) expression- release of IL-8 and granulocyte colony-stimulating factor (G-CSF) from bronchial fibroblasts- secretion of granulocyte-macrophage colony-stimulating factor (GM-CSF), intercellular adhesion molecule 1 (ICAM-1), tumour necrosis factor alpha (TNF-α), matrix metalloproteinase-1 (MMP-1), and MMP-10 from epithelial cells- and production of thymic stromal lymphopoietin (TSLP) in the skin of mice and its release from T cells.PAR activation has been linked to inflammation and an increase in PAR-2 expression is seen in patients with septic shock.- Therefore compounds that-mimic or interfere with the PAR-activating processes are attractive therapeutic candidates.

Peptide H-FL^SLDYIPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

This peptide is recognised and cleaved by the enzyme Sortase A (SrtA) from-Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine. Cleavage results in the formation of a thioacyl intermediate between the peptide and SrtA. This intermediate is then resolved by the N-terminus of an (oligo)alanine residues as acyl acceptors, resulting in the creation of a new peptide bond that links the peptide and its biotin tag to the incoming nucleophile.- This method of protein labelling is known as sortagging.This peptide contains an C-terminal biotin tag for detection and purification.

Peptide H-ASMTNMELM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-FR^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

(RXR)4XB is a cationic membrane-penetrating peptide and is effective in delivering phosphorodiamidate morpholino oligonucleotides (PMOs) into eukaryotic cells such as Escherichia coli. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK) and used in several studies to aid entry of recombinant proteins into cells. The peptide sequence described, known as penetratin, was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the cell penetrating peptide.On this sequence the N terminal active cysteine has been protected by a 3-Nitro-2-pyridinesulfenyl group. This is a useful modification as it allows this peptide to be used as a carrier peptide in conjugation reactions- this is a particularly useful modification when the peptide-like molecule contains a free thiol group.

Peptide H-QTALVELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-G^^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Graft versus host (GVH) rejection has been linked to the mismatch of minor histocompatibility (H) antigens even when matched for the major antigens of the major histocompatibility complex (MHC). The minor H antigens are encoded by autosomal and Y chromosome genes, they function as supports to MHC during synthesis. The prevention of GVH disease induced by minor H antigens is currently managed with immunosuppression. Using models and H antigen epitopes can provide research in to how GVH disease could be better managed by inducing tolerance. Mice are the preferred model for H antigen research due to their homogeneity apart from the Y chromosomal genes of the males. The peptide provided here is the T-cell epitope for the male-specific transplantation antigen (H-Y). It was derived from the mouse ubiquitously transcribed tetratricopeptide repeat gene on the Y chromosome (Uty) protein. Uty HY Peptide has been used to investigate transplantation tolerance of male to female grafts by inhibiting the effector CD4+ and CD8+ T-cell responses.

Peptide H-ATEHLSTLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (251-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Galanin is a widely distributed neuropeptide in the central nervous system (CNS), peripheral regions and endocrine system. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy.Galanin interacts with 3 receptor subtypes, GalR1-3 which are G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of potassium ions.The galanin active N-terminal fragment (1-16) has been identified as a highly potent agonist for the galanin receptors.  This has become a basis for galanin-based peptides, which are neuroactive. These are being investigated as a potential source for anticonvulsant neuropeptides as a therapeutic for conditions such as epilepsy. A library of galanin fragments has allowed screening of their properties to be assessed. Galanin fragments have different affinities for GalR receptors. Galanin (1-13) has been shown to act as a high-affinity receptor antagonist in competitive receptor displacement tests using rats. Numerous chimeric peptides have been generated with galanin (1-13) to generate peptides for studying galinergic signalling. Examples of chimeric peptide tools used with galanin (1-13) are the neuropeptide Y fragment (named M32) and a bradykinin fragment (called M35).

ANP (9-22) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in the cardiovascular remodelling process.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in proANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.

Peptide H-APPDNLPSPGGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Jelleines are a family of very small (8-9 amino acid residues long) host defence peptides (HDPs) isolated from the royal jelly of honey bees (Apis mellifera). Jelleines do not present any similarity with other HDPs from other honeybees and are produced by the workers and secreted into Royal Jelly (RJ), providing abroad-spectrum protection of the bee hive against microbial infections. The Jelleines are not considered cytolytic or directly involved with inflammatory effects. Jelleine-II may be a product of a tryptic digestion of MRJP-1, which is produced in the hypopharyngeal glands of the worker honeybee and secreted into the RJ- an exoproteinase action either on N-or on C-terminal positions of the tryptic fragment could result in the formation of the Jelleines-I and -IV, respectively. Possess antimicrobial properties against yeast, fungi, gram-positive and gram-negative bacteria.PLEASE NOTE that in several published articles the sequence of Jelleine-2 has been printed as TPFKISLHL-NH2-NH2, due to a mistake in the original reference: Fontana et al., (2004). The correct sequence, is TPFKISIHL-NH2.

Mastoparan is a 14-residue cationic peptide toxin isolated from the wasp Vespula lewisii venom which shows an important potency as an antimicrobial and anticancer agent but also as a Cell Permeable Peptide.
Mastoparan is mainly known to be a receptor-independant and allosteric regulator of G-protein by stimulating GTPase activity.
Besides modulating the activity of G-protein, Mastoparan have the ability to bind other intracellular targets such as Ca2+-ATP (implicated in Ca2+ release), small GTP binding proteins rho and rac, and many others.
Mastoparan also belongs to the cell permeable peptide (CPP) family. As such, Mastoparan increases the membrane conductance and permeability of planar lipid bilayer and liposomal membranes which leads to enhanced the penetration of Ca2+, Na+ or K+ ions.
Mastoparan have also a potential antibiotic effect due to its potent antimicrobial activity which can turn Mastoparan to a potential drug for infectious diseases.
Some studies have also reported that Mastoparan exhibits potent anti-cancer activities toward leukemia, myeloma, and breast cancer cells with an approximately half maximal inhibitory concentration (IC50) of 9µM, 11µM and 22µM respectively.
Mastoparan have shown to be more specific to cancer cells than to normal cells.

Alyerserin-1b is a C-terminally α-amidated 23 residue Cationic anti-microbial peptide (AMP). Anti-microbial peptides (AMPs) are produced by the innate immune system and are expressed when the host is challenged by a pathogen. The Alyerserin family of peptides was first identified in norepinephrine-stimulated skin secretions of the midwife toad-Alytes obstetricans-(Alytidae). Alyteserin-1 peptides have limited structural similarity to the ascaphins from the skins of frogs of the Leiopelmatidae family. Alyteserin-1 peptides are selective at inhibiting growth activity of Gram-negative bacteria-such as Escherichia coli and show weak haemolytic activity against human erythrocytes.Alyteserin contain at least 50% hydrophobic amino acids. Hydrophobic residues contribute to the insertion of the peptide into the hydrophobic membrane core which results in membrane disruption and death of the pathogen. Due to their mechanism of action it is less likely for resistance to develop towards them compared to conventional antibiotics.

Peptide H-CPSSHSSLTERHKILHRLLQEGSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (86-100) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

Peptide H-KLPFQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Tumour antigens recognised by cytotoxic T cells (CTLs) are a keen area of research to develop antigen-specific cancer therapies. However, hurdles are weak immunogenicity and high rates of degradation in vivo. In the search for a melanoma vaccine, the human tumour antigen Melan-A/MART-1 (27-35) has been used as a model to design peptides with improved characteristics for use in anti-tumour vaccines. The MART-1 fragment provided here has an alanine substituted at position one from MART-1 (27-35) this is a natural variant of MART-1 found in the population. Melan-A specific CTL assays showed this MART-1 fragment A27L to be a superagonist with higher affinity than the parent peptide. Also, the MART-1 fragment is a more stable complex with HLA-A*0201 than the parent peptide as determined by degradation experiments using a functional cytolytic assay. The superagonist activity of the MART-1 fragment and the stability of the peptide may be a considerable step towards an anti-melanoma vaccine.

Cilengitide is a cyclic arginine-glycine-aspartic acid (RGD) motif containing peptide that selectively inhibits the integrin alphav subunit. Integrins are cell adhesion molecules which mediate cell-cell and cell-matrix interactions and creating a scaffold for tissue organisation. Integrins also act to regulate cell attachment, proliferation, differentiation, apoptosis and motility.Integrin alphav can form heterodimers with integrin subunits subunits β1, β3, β5, β6, or β8. Cilengitide is a highly specific antagonist of alphavβ3 and alphavβ5 integrins. It also and shows anti-angiogenic effects and inhibits growth and promotes apoptosis of tumour cells that express integrins, such as glioblastoma.Cilengitide has gone on to phase II trials for cancers such as glioblastoma, melanoma, prostate, breast, lung and head and neck cancers.

Connexin43 mimetic peptide which can reduce swelling, astrogliosis, neuroinflammation and neuronal cell death following spinal cord injury ex vivo and in vivo. Reduces mechanical pain hypersensitivity by specifically targeting the NLRP3 inflammasome in the spinal cord. Possesses analgesic effects in mouse neuropathic pain models.

Affinity chromatography and protein purification are more successful with highly selective ligands such as short peptides. Phage libraries have been utilised to identify novel peptides for target proteins. IgG1 monoclonal antibody is traditionally purified using protein A but is not ideal due to cost and methodology. EPIHRSTLTALL was found via phage library screening as the most selective ligand possible IgG1, and also highly stable. It binds to the constant region of IgG1 known as humanized anti-Tac (HAT). HAT is a humanized monoclonal antibody against the low-affinity p55 subunit of the interleukin IL-2 receptor.

Amino acids 1-24 of human adrenocorticotropic hormone (ACTH), induces glucocorticoid production by adrenal cells with the same potency as full length ACTH. ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor- ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency.

Galanin is a neuropeptide synthesised and released by the brainstem locus coeruleus (LC). Galanin is expressed in most LC neurons in rodents and humans. Galanin has been shown to inhibit LC activity by hyperpolarising LC neurons, suppressing their spontaneous firing rate, and enhancing alpha2-adrenergic receptor-mediated negative feedback. Galanin is also a potent trophic and neuroprotective factor throughout the nervous system.Galanin is widely distributed in the central nervous, peripheral, and endocrine systems. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes, GalR1-3, which are G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.N-terminal fragments are naturally occurring in vivo but their relevance is not clear. Some N-terminal fragments reduce metabolic and functional disorders in experimental heart damage. Using N-terminal fragments such as galanin (3-13) can clarify the function of full-length galanin during myocardial ischemia and reperfusion injury. This may highlight new agonists/antagonists for the galanin GalR receptors that can be putative therapeutic targets.A C-terminal biotin tag for easy detection and purification has been added to the galanin (3-13) fragment. Cymit Quimica Laboratories Ltd is a custom peptide provider. If you desire an alternate tag, please contact us to request a custom synthesis.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VTSEGAGLQLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-VYI^HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Biot-EAIYAAPFAKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ADGVGK^SAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TWLV^PDSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LPLAYPQWYYANSEEWTFPTE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SLETEILESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-NLVPMVATV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TVGVEPAADGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-CAEPQKSPW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VEIFYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-QVPSRPNRAP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-V^IFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GSGFFVFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Spike S peptide is a peptide pool made of 15-mer peptides with 11–amino acid (aa) overlap, covering the complete sequence of the Spike S protein.

Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EALDESIPPVSFWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VFSVSLSNPSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Octreotide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-RHRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Biot-PVKRRLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Myr-KFEEERARAKWDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-R^TPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SYGIPFIETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-PQAQQKSLLQQLLTE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide 1-Adamantanecarbonyl-Arg-Phe-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TPEVDDEALEK^FDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Biot-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-CKRRKIDDYFAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ATVVYQGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EQIIYGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-TTPPVLDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-Asp(OBzl)-Pro-Arg-MCA is a peptide that can activate the receptor GPRC6A. The peptide has been shown to activate the receptor by binding to it and activating the signal transduction pathway. This peptide is also an inhibitor of ion channels, such as voltage-gated potassium channels. Boc-Asp(OBzl)-Pro-Arg-MCA is a high purity product with CAS No. 113866-00-5.

sCD40 Mouse is a peptide that is used as a research tool to study the activation of CD40, an antibody that is used to activate CD40. sCD40 Mouse is an activator of CD40 and can be used in the inhibition of ion channels and protein interactions. It has a CAS number (1237-63-6) and acts as a ligand for receptor. sCD40 Mouse can be used in pharmacology to study protein interactions.

Peptide Ac-QEAFSHIRIPLPH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Leu-Pro-Phe-Phe-Asp-NH2 is a potential therapeutic for Alzheimer's disease. It has been shown to reduce the production of reactive oxygen species and inhibit the formation of amyloid beta oligomers. Ac-Leu-Pro-Phe-Phe-Asp-NH2 also reduces the frequency of protofibrils, which are aggregates that may play a role in Alzheimer's disease pathology. This peptide has been shown to have a protective effect on cell populations, which may lead to therapeutics that can delay or prevent Alzheimer's disease. Ac-Leu-Pro-Phe-Phe-Asp NH2 is an inhibitor of amyloid beta peptides and modulates their aggregation into protofibrils.

Amino-dPEG®4-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.