Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29713 produits trouvés pour "Peptides"
H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS :Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C159H267N49O43Degré de pureté :Min. 95%Masse moléculaire :3,553.13 g/molOrexin A (17-33) trifluoroacetate salt
CAS :Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesisFormule :C79H125N23O22Degré de pureté :Min. 95%Masse moléculaire :1,748.98 g/molFITC-beta-Ala-Amyloid beta-Protein (1-40)
CAS :Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C218H311N55O64S2Degré de pureté :Min. 95%Masse moléculaire :4,790.27 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molH-Arg(Pbf)-OtBu·HCl
CAS :Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C23H38N4O5S·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :519.1 g/molInsulin-like Growth Factor I (57-70)
Catalogue peptide; min. 95% purityFormule :C65H104N15O23SMasse moléculaire :1,495.7 g/molBoc-Gly-Arg-OH
CAS :Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C13H25N5O5Degré de pureté :Min. 95%Masse moléculaire :331.37 g/molSteroid Receptor Co-Factor Peptide
Catalogue peptide; min. 95% purity
Formule :C79H136N26O21Masse moléculaire :1,786.13 g/molBiotin-Insulin Receptor (1142-1153)
Catalogue peptide; min. 95% purityFormule :C82H121N21O26Masse moléculaire :1,849.07 g/molα-Conotoxin GS
Catalogue peptide; min. 95% purityFormule :C139H232N52O47S7Masse moléculaire :3,608.1 g/molProtein Kinase C substrate from EGF Receptor
Catalogue peptide; min. 95% purityFormule :C34H68N16O8Masse moléculaire :829.02 g/molP61 (343-355), M. leprae
Catalogue peptide; min. 95% purityFormule :C62H107N21O24Masse moléculaire :1,530.67 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
Catalogue peptide; min. 95% purityFormule :C43H59N11O8Masse moléculaire :858.02 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
Catalogue peptide; min. 95% purityFormule :C42H67N9O12Masse moléculaire :890.06 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formule :C63H98N16O23S3Masse moléculaire :1,543.77 g/molPreproenkephalin B (186-204), human
Catalogue peptide; min. 95% purityFormule :C78H115N21O36SMasse moléculaire :1,954.97 g/mol[D-Ser13]-Somatostatin-14
Catalogue peptide; min. 95% purityFormule :C76H104N18O19S2Masse moléculaire :1,637.91 g/molZ-Glu-Leu-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Z-Glu-Leu-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C19H26N2O7·C12H23NDegré de pureté :Min. 95%Masse moléculaire :575.74 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H243N41O31Masse moléculaire :3,080.83 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/molACTH (18-39) (human) (Adrenocorticotropic Hormone) (Biotin)
Catalogue peptide; min. 95% purity
Formule :C122H179N29O38Masse moléculaire :2,659.89 g/molAntho-Rwamide II
Catalogue peptide; min. 95% purityFormule :C30H44N10O6Masse moléculaire :640.79 g/molDelicious Peptide
CAS :Catalogue peptide; min. 95% purityFormule :C34H57N9O16Masse moléculaire :847.88 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formule :C59H86N16O15Masse moléculaire :1,259.44 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/molBiotin-Pancreatic Polypeptide, human
Catalogue peptide; min. 95% purityFormule :C195H301N55O56S3Masse moléculaire :4,407.99 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/mol[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)
Catalogue peptide; min. 95% purityFormule :C51H82N14O18Masse moléculaire :1,179.31 g/mol[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14
Catalogue peptide; min. 95% purity
Formule :C73H92N18O16S2Masse moléculaire :1,541.79 g/molN-Hippuryl-His-Leu trifluroacetate hydrate
CAS :Hippuryl-His-Leu trifluroacetate hydrate can be used as an artificial substrate for angiotensin-converting enzyme (ACE).Formule :C21H27N5O5(C2F3O2)x(H2O)xDegré de pureté :Min. 95%Masse moléculaire :429.47 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C216H343N67O60Masse moléculaire :4,838.43 g/molPrepro-Neuromedin U (104-136) (human)
Catalogue peptide; min. 95% purityFormule :C177H277N47O45Masse moléculaire :3,783.47 g/molPrepro VIP (111-122) (human)
Catalogue peptide; min. 95% purityFormule :C53H87N13O21Masse moléculaire :1,242.36 g/moln-Decyltetraoxyethylene
CAS :N-Decyltetraoxyethylene is a fatty acid that can be synthesized by reacting naphthalene with ethylene oxide. It is used as a surfactant in pharmaceutical preparations and has been shown to have affinity for ligands such as anionic and cationic surfactants, fatty acids, and model proteins. N-Decyltetraoxyethylene also has antiviral properties, binding to influenza virus particles. This compound has been shown to exhibit bronchiolitis obliterans when administered to animals in vivo. The particle size of this compound is too small for it to be used as a respiratory inhalant drug, but the high surface area of the molecule allows it to be used as a nasal or eye drug.
Formule :C18H38O5Degré de pureté :Min. 95%Couleur et forme :Clear LiquidMasse moléculaire :334.49 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molBig Endothelin-1 (1-39), porcine
Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page
Ac-Endothelin-1 (16-21), human
Catalogue peptide; min. 95% purity
Formule :C41H59N9O10Masse moléculaire :837.98 g/molbeta-Casomorphin (1-4), amide (bovine)
Catalogue peptide; min. 95% purityFormule :C28H35N5O5Masse moléculaire :521.62 g/molPRRS-PQGAB-N
Catalogue peptide; min. 95% purityFormule :C54H76N12O24SMasse moléculaire :1,309.33 g/molH-Ile-Ala-OH
CAS :H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.Formule :C9H18N2O3Degré de pureté :Min. 95%Masse moléculaire :202.25 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-Ile-Pro-OH
CAS :H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.Formule :C11H20N2O3Degré de pureté :Min. 95%Masse moléculaire :228.29 g/molZ-Ile-Pro-OH
CAS :Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.
Formule :C19H26N2O5Degré de pureté :Min. 95%Masse moléculaire :362.42 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS :Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C34H51N11O7•C2HF3O2Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :839.86 g/molbeta-MSH, porcine
Catalogue peptide; min. 95% purityFormule :C98H138N26O29SMasse moléculaire :2,176.36 g/molParathyroïd Hormone(1-34), bovine
Catalogue peptide; min. 95% purity
Formule :C183H288N54O50S2Masse moléculaire :4,108.7 g/molγ-TAC4 (32-50)
Catalogue peptide; min. 95% purity
Formule :C92H146N24O31Masse moléculaire :2,084.33 g/mol[Tyr15]-Fibrinopeptide B
Catalogue peptide; min. 95% purity
Formule :C75H102N20O27Masse moléculaire :1,715.78 g/molFlagellin 22 trifluoroacetate
CAS :Please enquire for more information about Flagellin 22 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C93H162N32O34•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,728.56 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formule :C157H253N53O42Masse moléculaire :3,555.01 g/molC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formule :C23H40N6O10Masse moléculaire :560.61 g/molFibrinogen beta-Chain (24-42)
Catalogue peptide; min. 95% purityFormule :C86H135N25O27Masse moléculaire :1,951.19 g/molLL-37 pentamide
Catalogue peptide; min. 95% purityFormule :C208H343N65O48Masse moléculaire :4,522.46 g/mol26Rfa, Hypothalamic Peptide, frog
Catalogue peptide; min. 95% purityFormule :C127H197N37O36Masse moléculaire :2,818.21 g/molAc-Hirudin (55-65) (desulfated)
Catalogue peptide; min. 95% purityFormule :C66H92N12O25Masse moléculaire :1,453.53 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formule :C147H227N39O43SMasse moléculaire :3,260.75 g/molSH2 Domain Ligand (5)
Catalogue peptide; min. 95% purity
Formule :C41H62N7O16PSMasse moléculaire :972.05 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS :Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formule :C54H103NO7SDegré de pureté :Min. 95%Masse moléculaire :910.46 g/molH-Val-Val-Val-OH
CAS :H-Val-Val-Val-OH is an enantiomer of H-Val-Gly-Thr-Phe, a linear model of the apical region of the Caco2 cell. It is also a monolayer that has hydrogen bonds with other molecules. Molecular modeling shows that H-Val-Val-Val-OH inhibits the uptake of glucose by Caco2 cells. The transport properties of this molecule are not well understood, but it may inhibit glucose transport in the small intestine by binding to glucose transporter 2 (GLUT2). Chromatographic methods have been used to analyze H-Val-Val-Val-OH and its inhibition on growth factor activity.
Formule :C15H29N3O4Degré de pureté :Min. 95%Masse moléculaire :315.41 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS :Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C247H361N57O80S2Degré de pureté :Min. 95%Masse moléculaire :5,472.98 g/molH-Glu-Ala-OH
CAS :H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br> br>br> This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (Formule :C8H14N2O5Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :218.21 g/molErythromycin resistance peptide
Catalogue peptide; min. 95% purityFormule :C31H52N8O6SMasse moléculaire :664.86 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS :L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.Formule :C30H62N10O6Degré de pureté :Min. 95%Masse moléculaire :658.88 g/molZ-Leu-Leu-Arg-AMC
CAS :Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.Formule :C36H49N7O7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :691.82 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formule :C72H122N21O29SMasse moléculaire :1,777.92 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molbeta-Amyloid (10-20)
Catalogue peptide; min. 95% purityFormule :C71H99N17O16Masse moléculaire :1,446.68 g/molBiotin-Amyloid beta-Protein (1-40)
Catalogue peptide; min. 95% purity
Formule :C204H309N55O60S2Masse moléculaire :4,556.20 g/molPhosphatase Substrate
Catalogue peptide; min. 95% purityFormule :C33H65N12O11PMasse moléculaire :836.95 g/mol4-Alkoxybenzyl alcohol resin (100-200 mesh)
CAS :4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.Couleur et forme :PowderAmyloid beta-Protein (35-25) trifluoroacetate salt
CAS :Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C45H81N13O14SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,060.27 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formule :C137H212N42O39SMasse moléculaire :3,103.54 g/molDABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt
CAS :DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt is a fluorescent substrate for the SARS coronavirus. This compound is an inhibitor of the enzyme that is the target of a drug candidate that inhibits the replication of this virus. Molecular docking studies have shown that DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt binds to 3clpro, which is part of the active site of the enzyme’s catalytic pocket. Inhibition activity was seen in experiments using recombinant proteins, and kinetic analysis showed this inhibitor has a Ki value of 0.7 mM.Formule :C95H141N25O24S2·C2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :2,195.47 g/molα-Helical CRF (9-41)
Catalogue peptide; min. 95% purityFormule :C166H274N46O53S2Masse moléculaire :3,826.44 g/molAc-g-Endorphin
Catalogue peptide; min. 95% purity
Formule :C85H133N19O28SMasse moléculaire :1,901.18 g/mol[Ala18] Endothelin-1, human
Catalogue peptide; min. 95% purityFormule :C108H163N25O30S5Masse moléculaire :2,451.94 g/molα-CGRP (23-37) (human)
Catalogue peptide; min. 95% purityFormule :C74H117N21O20Masse moléculaire :1,620.89 g/molR-G-D-S-P-A-S-S-K-P
Catalogue peptide; min. 95% purityFormule :C40H68N14O16Masse moléculaire :1,001.07 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS :H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.Formule :C44H63N11O13Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :954.04 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C44H49FN4O14Degré de pureté :Min. 95%Masse moléculaire :876.88 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS :Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C29H28N2O7SDegré de pureté :Min. 95%Masse moléculaire :548.61 g/molα-Conotoxin MI
Catalogue peptide; min. 95% purityFormule :C58H92N22O17S4Masse moléculaire :1,497.74 g/molbeta-Endorphin (1-26), human
Catalogue peptide; min. 95% purityFormule :C130H208N32O38SMasse moléculaire :2,859.36 g/molRSK Substrate, S6 (231-239)
Catalogue peptide; min. 95% purityFormule :C45H88N22O11Masse moléculaire :1,113.34 g/mol[D-Ala2]-beta-Casomorphin (1-4) amide (bovine)
Catalogue peptide; min. 95% purityFormule :C26H33N5O5Masse moléculaire :495.58 g/molAtrial Natriuretic Factor (4-28) (human)
Catalogue peptide; min. 95% purityFormule :C112H175N39O35S3Masse moléculaire :2,724.02 g/molCDPKS, Syntide analog
Catalogue peptide; min. 95% purityFormule :C47H86N16O13Masse moléculaire :1,083.31 g/mol
![[Phe7] Dynorphin A (1-7), amide, porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00865.webp&w=3840&q=75)
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[D-Ser13]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00217.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00712.webp&w=3840&q=75)
![[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00275.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Tyr15]-Fibrinopeptide B](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00181.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00729.webp&w=3840&q=75)
![[Ala18] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00289.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00833.webp&w=3840&q=75)
