Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29729 produits trouvés pour "Peptides"
Dynorphin A (8-17), porcine
Catalogue peptide; min. 95% purityFormule :C59H96N18O15Masse moléculaire :1,297.53 g/mol[D-Ala2] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formule :C28H37N5O7SMasse moléculaire :587.70 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formule :C60H102N16O17Masse moléculaire :1,319.58 g/molMARCKS Protein (159-165)
Catalogue peptide; min. 95% purityFormule :C45H72N10O9Masse moléculaire :897.14 g/mol[Met5, Lys6,7] a-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purityFormule :C39H59N9O9SMasse moléculaire :830.02 g/mol[Tyr11]-Somatostatin
Catalogue peptide; min. 95% purity
Formule :C76H102N18O20S2Masse moléculaire :1,651.91 g/molα-Conotoxin GI
Catalogue peptide; min. 95% purityFormule :C55H76N20O18S4Masse moléculaire :1,433.63 g/molGRF (human) acetate salt
CAS :Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H358N72O66SDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :5,039.65 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molSialokinin - 2
Catalogue peptide; min. 95% purity
Formule :C51H76N12O16SMasse moléculaire :1,145.31 g/molbeta-Amyloid (1-33)
Catalogue peptide; min. 95% purityFormule :C164H242N46O51Masse moléculaire :3,673.94 g/molBig Endothelin-1 (1-39), porcine
Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page
Lamprey PQRFamide
Catalogue peptide; min. 95% purity
Formule :C102H147N29O22S2Masse moléculaire :2,195.62 g/mol[Val3]-beta-Casomorphin (1-4) amide (bovine)
Catalogue peptide; min. 95% purityFormule :C24H35N5O5Masse moléculaire :473.58 g/molH-Thr-Asp-OH TFA salt
CAS :Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H14N2O6C2F3HO2Degré de pureté :Min. 95%Masse moléculaire :348.23 g/molZ-Ile-Trp-OH
CAS :Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C25H29N3O5Degré de pureté :Min. 95%Masse moléculaire :451.51 g/molBone Matrix Proteins
Catalogue peptide; min. 95% purityFormule :C40H67N13O14Masse moléculaire :954.06 g/molCathepsin S substrate
Catalogue peptide; min. 95% purity
Formule :C41H66N12O9Masse moléculaire :871.08 g/molMMP-2/MMP-9 Substrate I, fluorogenic
Catalogue peptide; min. 95% purityFormule :C44H61N13O13SMasse moléculaire :1,012.1 g/mol[Nle21,Tyr32] Corticotropin Releasing Factor, ovine
Catalogue peptide; min. 95% purityFormule :C209H343N57O64Masse moléculaire :4,678.29 g/mol[Ile76]-TNF-a (70-80) (human)
Catalogue peptide; min. 95% purity
Formule :C55H91N15O16Masse moléculaire :1,218.43 g/molProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Formule :C153H259N49O52Masse moléculaire :3,616.98 g/molgp100 (619-627)
Catalogue peptide; min. 95% purityFormule :C49H82N14O14SMasse moléculaire :1,123.35 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
Catalogue peptide; min. 95% purityFormule :C61H110N24O14Masse moléculaire :1,403.71 g/molProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formule :C103H156N32O25Masse moléculaire :2,242.59 g/mol4A/4B, Peptide (1)
Catalogue peptide; min. 95% purityFormule :C67H100N16O25S2Masse moléculaire :1,593.76 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formule :C63H98N18O13SMasse moléculaire :1,347.66 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formule :C96H156N34O31SMasse moléculaire :2,314.59 g/molGPC3 (298-306), mouse
Catalogue peptide; min. 95% purityFormule :C51H81N9O18Masse moléculaire :1,108.26 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
Catalogue peptide; min. 95% purityFormule :C43H59N11O8Masse moléculaire :858.02 g/molLL-37 pentamide
Catalogue peptide; min. 95% purityFormule :C208H343N65O48Masse moléculaire :4,522.46 g/molpp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphorylated
Catalogue peptide; min. 95% purityFormule :C62H95N16O28PMasse moléculaire :1,543.53 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid beta-Protein (33-40)
Catalogue peptide; min. 95% purityFormule :C58H99N19O18S2Masse moléculaire :1,414.67 g/molBiotin-Parathyroid Hormone (1-34), human
Catalogue peptide; min. 95% purityFormule :C191H305N57O53S3Masse moléculaire :4,344 g/molAntho-Rwamide II
Catalogue peptide; min. 95% purityFormule :C30H44N10O6Masse moléculaire :640.79 g/molEpidermal Mitosis Inhibiting Pentapeptide
Catalogue peptide; min. 95% purity
Formule :C19H27N5O12Masse moléculaire :517.45 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formule :C35H41N11O7Masse moléculaire :727.79 g/mol[Asp5,6,Me-Phe8] Substance P
Catalogue peptide; min. 95% purityFormule :C40H56N8O11SMasse moléculaire :857.00 g/mol[D-Met2,Pro5] Enkephalin, amide
Catalogue peptide; min. 95% purityFormule :C30H40N6O6SMasse moléculaire :612.75 g/molMating Factor aSK2
Catalogue peptide; min. 95% purityFormule :C81H106N18O19SMasse moléculaire :1,667.92 g/molp60c-src Substrate I
Catalogue peptide; min. 95% purityFormule :C44H60N8O11Masse moléculaire :877.01 g/mol[D-Pro2]-beta-Casomorphin (1-5) ,bovine
Catalogue peptide; min. 95% purityFormule :C30H37N5O7Masse moléculaire :579.66 g/mol[Pyr5]-Substance P (5-11)
Catalogue peptide; min. 95% purityFormule :C41H57N9O9SMasse moléculaire :852.05 g/mol[Ala9,10, Lys11,12] Glycogen Synthase (1-12)
Catalogue peptide; min. 95% purityFormule :C56H103N17O16Masse moléculaire :1,270.7 g/molα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Formule :C40H61N11O9Masse moléculaire :840.00 g/mol[Tyr22]-a-CGRP (22-37), rat
Catalogue peptide; min. 95% purityFormule :C82H120N20O25Masse moléculaire :1,785.99 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Formule :C123H195N31O39Masse moléculaire :2,732.04 g/molUremic Pentapeptide (U5-Peptide)
Catalogue peptide; min. 95% purityFormule :C32H48N8O9Masse moléculaire :688.8 g/mol[D-Phe11]-Neurotensin
Catalogue peptide; min. 95% purity
Formule :C78H121N21O19Masse moléculaire :1,657 g/molGrowth Hormone Releasing Factor, GRF, (1-40), human
Catalogue peptide; min. 95% purityFormule :C194H317N61O63SMasse moléculaire :4,544.02 g/molIGF-I (30-41)
CAS :Please enquire for more information about IGF-I (30-41) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C51H83N19O19Degré de pureté :Min. 95%Masse moléculaire :1,266.32 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molProlactin Releasing Peptide (12-31), rat
Catalogue peptide; min. 95% purityFormule :C104H158N32O26Masse moléculaire :2,272.62 g/molbeta-Amyloid (1-49)
Catalogue peptide; min. 95% purity
Formule :C239H376N62O69SMasse moléculaire :5,253.97 g/molLaminin Penta Peptide, amide
Catalogue peptide; min. 95% purity
Formule :C26H43N9O7Masse moléculaire :593.7 g/mol[Tyr15] Fibrinopeptide B, human
Catalogue peptide; min. 95% purityFormule :C75H102N20O27Masse moléculaire :1,715.78 g/molbeta-Amyloid (12-28) - Cys
Catalogue peptide; min. 95% purityFormule :C92H140N26O26SMasse moléculaire :2,058.36 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formule :C190H288N54O57Masse moléculaire :4,240.64 g/molAmyloid beta-Protein (20-29)
Catalogue peptide; min. 95% purityFormule :C43H66N12O17Masse moléculaire :1,023.08 g/mol[Thr30]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formule :C187H280N54O59SMasse moléculaire :4,260.6 g/molActh (1-4)
CAS :Acth (1-4) is the ACTH N-terminal tetrapeptide.Formule :C20H30N4O8SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :486.545-azido-pentanoyl-RKKRRQRRR-NH2 TFA salt
Peptide 5-azido-pentanoyl-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Couleur et forme :PowderMasse moléculaire :1,463.78 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molZ-VRPR-FMK trifluoroacetate
CAS :Z-VRPR-FMK trifluoroacetate is an apoptosis-inducing inhibitor that works by inhibiting a specific kinase in the human body. It has been shown to have anti-cancer properties and may be useful in the treatment of various types of cancer. Z-VRPR-FMK trifluoroacetate is a menthol analog that acts as an inhibitor of apoptosis, which is the process by which cells die naturally. This compound has been tested on Chinese hamster ovary cells and has been found to be effective at inducing apoptosis in these cells. Additionally, Z-VRPR-FMK trifluoroacetate has been shown to inhibit tylosin-induced apoptosis in human colon cancer cells. Overall, this compound shows promise as a potential therapeutic agent for the treatment of cancer and other diseases.Formule :C34H50F4N10O9Degré de pureté :Min. 95%Masse moléculaire :818.8 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molH-Gly-Leu-Gly-OH trifluroacetate
CAS :Please enquire for more information about H-Gly-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C10H19N3O4•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :359.3 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS :LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)Formule :C34H38N8O9Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :702.71 g/molH-Leu-Leu-Gly-OH trifluroacetate
CAS :Please enquire for more information about H-Leu-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H27N3O4•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :415.4 g/molSermorelin acetate
CAS :Produit contrôléSermorelin acetate is a synthetic peptide, which is an analogue of the naturally occurring growth hormone-releasing hormone (GHRH). It is derived from recombinant DNA technology, representing the first 29 amino acids (1-29) of endogenous GHRH. Its mode of action involves binding to and activating the GHRH receptor on the anterior pituitary gland, which subsequently stimulates the release of growth hormone (GH) into the bloodstream.
Formule :C149H246N44O42S·C2H4O2Degré de pureté :Min. 95%Masse moléculaire :3,417.94 g/mol1-Palmitoyl-rac-glycero-3-phosphocholine
CAS :1-Palmitoyl-rac-glycero-3-phosphocholine is a biological lipid that has been shown to be a potent growth factor for cells in culture. It binds to DNA and modulates transcriptional regulation. 1-Palmitoyl-rac-glycero-3-phosphocholine also inhibits the production of lysophosphatidylcholine, which is an inflammatory mediator that promotes the release of histamine from mast cells. This compound may be useful as an antimicrobial agent, as it has been shown to inhibit the growth of bacteria and fungi.Formule :C24H50NO7PDegré de pureté :Min. 95%Masse moléculaire :495.63 g/molRetatrutide acetate
CAS :Acetate salt; GLP-1, GIP, and GCGR2 mimic; Obesity researchFormule :C221H342N46O68•(C2H4O2)xCouleur et forme :PowderMasse moléculaire :4,791.38 g/molCyclo(L-alanyl-L-tryptophyl) trifluoroacetate
CAS :Please enquire for more information about Cyclo(L-alanyl-L-tryptophyl) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C14H15N3O2•(C2HF3O2)xDegré de pureté :Min. 95%Masse moléculaire :257.29 g/molTPCN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TPCN1 antibody, catalog no. 70R-5158Degré de pureté :Min. 95%H-Met-Gln-OH TFA salt
CAS :H-Met-Gln-OH TFA salt is a recombinant human metalloproteinase that has been shown to activate polymorphonuclear and mononuclear cells. H-Met-Gln-OH TFA salt enhances the production of reactive oxygen species and induces the release of proinflammatory cytokines such as tumor necrosis factor alpha, interleukin 1, and interleukin 6. This protein also cleaves sulfoxide bonds in proteins, which may be due to its ability to catalyze the oxidation of sulfhydryl groups in proteins. H-Met-Gln-OH TFA salt has been shown to be effective in enhancing red blood cell production, which may be due to its ability to cleave hemoglobin S bonds in erythrocytes.Formule :C10H19N3O4SDegré de pureté :Min. 95%Masse moléculaire :277.34 g/molPheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea)
CAS :Please enquire for more information about Pheromone Cymit Quimicaesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C167H259N47O57S2Degré de pureté :Min. 95%Masse moléculaire :3,901.26 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin
CAS :Hydroxy-4-methyl-Orn7)-phalloidin is a cyclic peptide toxin is specifically used for staining and visualizing F-actin (filamentous actin) in biological samples.Formule :C35H49N9O10SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :787.88 g/molMycosubtilin
CAS :Mycosubtilin is a potent antifungal lipopeptide, which is a secondary metabolite produced by the bacterium Bacillus subtilis. It is characterized by its ability to disrupt fungal cell membranes, leading to cell lysis and eventual death of the fungus. This mode of action is attributed to its amphiphilic structure, which allows it to integrate into the lipid bilayers of fungal cells, compromising the integrity of the membrane and altering its permeability.Mycosubtilin finds applications in various scientific and agricultural fields due to its efficacy against a broad spectrum of fungal pathogens. It is particularly useful in plant disease management, where it plays a role in biocontrol strategies against phytopathogenic fungi. Additionally, its antifungal properties make it a subject of interest in pharmaceutical research, where it is investigated for potential therapeutic applications in combating fungal infections. Researchers also explore Mycosubtilin as a model compound to understand lipopeptide interactions with membranes, contributing to the broader knowledge of antimicrobial agents.Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt
CAS :Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is a fluorescent marker that can be used in immunohistochemical staining. It binds to endogenous vasoactive intestinal peptide, calcitonin and other proteins in tissues and can be detected using immunostaining. Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH trifluoroacetate salt is optimised for use as a substrate for neutral endopeptidase and metalloendopeptidase enzymes, which are responsible for the degradation of vasoactive intestinal peptide.Formule :C28H32N6O9S·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :742.68 g/molLysyllysyllysine
CAS :Lysyllysyllysine is a cationic moiety. It may be used in the construction of gene delivery vectors and DNA nanoparticles.Formule :C18H38N6O4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :402.53LH-RH, Salmon
This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Neuropeptide Y-Lys(biotin), Human, rat
This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Formule :C199H300N57O60S2Masse moléculaire :4515.04Proctolin
CAS :Proctolin modulates interneuronal and neuromuscular synaptic transmission in a wide variety of arthropods. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Formule :C30H48N8O8Masse moléculaire :648.76Substance P-Gly-Lys-Arg
This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Formule :C77H124N24O17SMasse moléculaire :1690.05Histatin 5
This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Oxyntomodulin
CAS :This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Formule :C192H295N59O60SCouleur et forme :Lyophilized powder, WhiteMasse moléculaire :4421.9Somatostatin 28
CAS :This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Formule :C137H207N41O39S3Couleur et forme :White to off-white, PowderMasse moléculaire :3148.58GSK-3 Inhibitor X
This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Dynorphin A (1-13), Porcine
CAS :This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.
Couleur et forme :Lyophilized powder
![[D-Ala2] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00839.webp&w=3840&q=75)
![[Met5, Lys6,7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00874.webp&w=3840&q=75)
![[Tyr11]-Somatostatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00218.webp&w=3840&q=75)
![[Val3]-beta-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00914.webp&w=3840&q=75)
![[Nle21,Tyr32] Corticotropin Releasing Factor, ovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00739.webp&w=3840&q=75)
![[Ile76]-TNF-a (70-80) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00637.webp&w=3840&q=75)
![[Phe7] Dynorphin A (1-7), amide, porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00865.webp&w=3840&q=75)
![Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00729.webp&w=3840&q=75)
![[Asp5,6,Me-Phe8] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00320.webp&w=3840&q=75)
![[D-Met2,Pro5] Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00841.webp&w=3840&q=75)
![[D-Pro2]-beta-Casomorphin (1-5) ,bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00843.webp&w=3840&q=75)
![[Pyr5]-Substance P (5-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00195.webp&w=3840&q=75)
![[Ala9,10, Lys11,12] Glycogen Synthase (1-12)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00635.webp&w=3840&q=75)
![[Tyr22]-a-CGRP (22-37), rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00924.webp&w=3840&q=75)
![[D-Phe11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00191.webp&w=3840&q=75)
![[Tyr15] Fibrinopeptide B, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00156.webp&w=3840&q=75)
![[Thr30]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00913.webp&w=3840&q=75)
