Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30471 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
[D-Val22] Big Endothelin-1 (16-38), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H180N32O33Masse moléculaire :2,586.96 g/mol[Cys3, 6, Tyr8, Pro10]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,295.6 g/molβ-Amyloid (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formule :C170H253N47O52Masse moléculaire :3,787.20 g/mol[APLILSR]pPSA
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H131N21O22SMasse moléculaire :1,771.12 g/molCrustacean Erythrophore Concentrating Hormone
<p>Catalogue peptide; min. 95% purity</p>Formule :C45H59N11O11Masse moléculaire :930.04 g/molRF-amide peptide, Drosophila
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H86N16O15Masse moléculaire :1,247.43 g/molPlatelet-Derived Growth Factor Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formule :C52H81N12O19PMasse moléculaire :1,209.29 g/molMARCKS Substrate (151-175)
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H246N41O40P3Masse moléculaire :3,320.78 g/molAdipokinetic Hormone II Locusta Migratoria
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H57N11O11Masse moléculaire :904.02 g/molGastric Inhibitory Polypeptide (1-30) (porcine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C162H244N40O48SMasse moléculaire :3,551.97 g/molProtein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,280.74 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H44N6O12Masse moléculaire :716.8 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H121N25O18SMasse moléculaire :1,621 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C198H312N62O58Masse moléculaire :4,488.96 g/molβ-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H126N24O24Masse moléculaire :1,856.09 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molBiotin-a-CGRP (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C173H281N53O51S2Masse moléculaire :4,015.69 g/molβ-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Formule :C95H152N30O31Masse moléculaire :2,210.45 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/molSarafotoxin S6d
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C41H43FN4O14Degré de pureté :Min. 95%Masse moléculaire :834.8 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H108N16O24S5Masse moléculaire :1,718.02 g/molAngiotensinogen (1-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H116N22O17Masse moléculaire :1,645.9 g/molInsulin B (22-25)
CAS :<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H35N7O5Degré de pureté :Min. 95%Masse moléculaire :525.6 g/molInterleukin II (60-70)
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H104N14O14SMasse moléculaire :1,373.74 g/molKinase Domain of Insulin Receptor (4)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molCK1tide
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H96N18O27Masse moléculaire :1,549.58 g/molMurine CMV pp 89 (170-174)
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H41N7O7SMasse moléculaire :631.76 g/molScyliorhinin II, amide ,dogfish
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H119N21O26S3Masse moléculaire :1,851.1 g/mol[Lys15]-Amyloid β-Protein (15-21)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H69N9O8Masse moléculaire :852.10 g/molHistone H1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H101N17O15Masse moléculaire :1,252.53 g/molabII probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H101N19O19SMasse moléculaire :1,460.69 g/molAutocamtide-3 [KKALHRQETVDAL]
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H113N21O20Masse moléculaire :1,508.75 g/mol[D-Pro10]-Dynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molβ-Amyloid (11-22)
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H102N18O18Masse moléculaire :1,483.70 g/molDoc-6 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H134N26O26SMasse moléculaire :1,980.25 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H97N21O14SMasse moléculaire :1,512.8 g/molPACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H357N67O56S2Masse moléculaire :4,888.83 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H77N21O12Masse moléculaire :1,068.22 g/molBig Endothelin-1 (22-39), rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H135N25O27Masse moléculaire :5,511 g/mol[Val35] -β-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C203H311N55O60Masse moléculaire :4,481.96 g/molH-Trp-Trp-OH
CAS :<p>H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.</p>Formule :C22H22N4O3Degré de pureté :Min. 95%Masse moléculaire :390.44 g/molZ-Gly-Val-OH
CAS :<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formule :C15H20N2O5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :308.33 g/molH-Ile-Ile-Ile-OH acetate salt
CAS :<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C18H35N3O4Degré de pureté :Min. 95%Masse moléculaire :357.49 g/molFmoc-Lys(Nde)-OH
CAS :<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C32H29N3O8Degré de pureté :Min. 95%Masse moléculaire :583.59 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,745.99 g/molH-D-Ala-Gln-octadecyl ester·HCl
CAS :<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H51N3O4·HClDegré de pureté :Min. 95%Masse moléculaire :506.16 g/molω-Conotoxin MVIIC
CAS :Produit contrôlé<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>Formule :C106H178N40O32S7Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,749.26 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS :<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C29H28N2O7SDegré de pureté :Min. 95%Masse moléculaire :548.61 g/mol[Lys0]-γ-1-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :1,641.1 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/molSKIGKV-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H55N9O7Masse moléculaire :629.81 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C142H223N35O53S2Masse moléculaire :3,332.68 g/molα-Neo-Endorphin Analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O13Masse moléculaire :1,383.68 g/molPKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C92H151N28O32PMasse moléculaire :2,192.39 g/molAGRP (87-132), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H339N65O63S11Masse moléculaire :5,243.17 g/molA-A-A-Y-G-G-F-L
<p>Catalogue peptide; min. 95% purity</p>Formule :C37H52N8O10Masse moléculaire :768.87 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H67N13O14Masse moléculaire :1,074.19 g/molCarassin (Carrassius Auratus)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molDynorphin A (2-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molβ-Amyloid (16-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H52N6O6Masse moléculaire :652.84 g/molForkhead derived peptide, Woodtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H123N21O20SMasse moléculaire :1,586.93 g/molSMCX (963-973) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H81N13O18Masse moléculaire :1,128.26 g/mol[Pyr6]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H49N7O7SMasse moléculaire :723.91 g/molβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H64N12O19Masse moléculaire :1,005.01 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molβ-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molMyristoylated ADP-Ribosylation Factor 1, myr-ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H157N21O22Masse moléculaire :1,993.49 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formule :C38H54N8O10Masse moléculaire :782.90 g/molβ-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H209N41O46Masse moléculaire :3,262.53 g/molβ-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H126N24O21S2Masse moléculaire :1,896.22 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C219H365N73O66SMasse moléculaire :5,108.86 g/molZ-His-Phe-OH
CAS :<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C23H24N4O5Degré de pureté :Min. 95%Masse moléculaire :436.46 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H108N22O16Masse moléculaire :1,453.72 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C205H340N60O53Masse moléculaire :4,493.37 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H71N13O15Masse moléculaire :1,070.18 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H150N26O31SMasse moléculaire :2,172.46 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N13O14S2Masse moléculaire :1,046.24 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H159N29O31Masse moléculaire :2,311.60 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H137N25O35Masse moléculaire :2,045.16 g/molMMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H63N13O13Masse moléculaire :1,042.14 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H80N12O14Masse moléculaire :1,145.3 g/molβ-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C23H28N4O4Masse moléculaire :424.50 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H43N7O6SMasse moléculaire :701.85 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H91N17O15Masse moléculaire :1,254.47 g/molWWamide-3
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H66N12O9SMasse moléculaire :963.18 g/molHIV-gp41-Antigenic Peptide 5
<p>Catalogue peptide; min. 95% purity</p>Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS :<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H66N12O12Degré de pureté :Min. 95%Masse moléculaire :955.07 g/molRS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H85N25O15Masse moléculaire :1,204.33 g/molα-Casein (90-95)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molHPV-E6-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H128N24O25SMasse moléculaire :1,810.07 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H91N21O14Masse moléculaire :1,246.45 g/molBig Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>HIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H164N32O31SMasse moléculaire :2,534.86 g/molDok-5 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formule :C75H114N24O19Masse moléculaire :1,655.89 g/mol
![[D-Val22] Big Endothelin-1 (16-38), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00479.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[APLILSR]pPSA](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00239.webp&w=3840&q=75)
![[Lys15]-Amyloid β-Protein (15-21)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00531.webp&w=3840&q=75)
![Autocamtide-3 [KKALHRQETVDAL]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00520.webp&w=3840&q=75)
![[D-Pro10]-Dynorphin A (1-11), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00870.webp&w=3840&q=75)
![[Val35] -β-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[Lys0]-γ-1-MSH (41-58), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00561.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
