Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30473 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Saposin C12
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H108N16O22Masse moléculaire :1,429.65 g/molCAP-18, rabbit
<p>Catalogue peptide; min. 95% purity</p>Formule :C202H356N64O47Masse moléculaire :4,433.49 g/molβ-Amyloid(1-16), mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C80H116N26O26Masse moléculaire :1,857.98 g/molUru-TK II, Urechistachykinin II
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H66N14O10SMasse moléculaire :983.17 g/molNeo-Kyotorphin
CAS :<p>Catalogue peptide; min. 95% purity</p>Formule :C28H47N9O9Masse moléculaire :653.74 g/molN-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H65O7N9Masse moléculaire :824.04 g/molVal-Asp-(Arg8)-Vasopressin
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H79N17O16S2Masse moléculaire :1,298.48 g/molβ-Endorphin (1-27), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C139H217N33O40SMasse moléculaire :3,022.54 g/molBiotin-VIP (human, bovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H252N46O44S2Masse moléculaire :3,552.17 g/molSendai Virus Nucleoprotein (321-336)
<p>Catalogue peptide; min. 95% purity</p>Formule :C85H110N20O23Masse moléculaire :1,779.93 g/molRF-amide, Chicken
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H53N9O5Masse moléculaire :643.84 g/molγ-Neuropeptide, rabbit
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H158N34O29SMasse moléculaire :2,320.64 g/molG-R-G-E-T-P
<p>Catalogue peptide; min. 95% purity</p>Formule :C24H41N9O10Masse moléculaire :615.7 g/molEndokinin A/B
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H77N13O12SMasse moléculaire :1,084.32 g/molRnase (90-105)
<p>H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity</p>Formule :C80H124N24O25SMasse moléculaire :1,854.08 g/molCalcitonin (8-32) (salmon I)
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H198N36O37Masse moléculaire :2,725.06 g/molAntioxidant peptide A
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H54N12O7S2Masse moléculaire :770.97 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C58H77N13O10Masse moléculaire :1,116.34 g/molMyristoylated Protein Kinase C (19-31)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H144N26O26Masse moléculaire :1,754.23 g/molProdynorphin (228-256), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C161H236N42O48Masse moléculaire :3,527.93 g/mol[Tyr1]-δ-Sleep Inducing Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H47N9O16Masse moléculaire :825.79 g/molMMP Biotinylated Substrate I
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H86N14O11Masse moléculaire :1,127.43 g/molBiotin-Calcitonin (salmon I)
<p>Catalogue peptide; min. 95% purity</p>Formule :C155H254N46O50S3Masse moléculaire :3,658.22 g/mol[Lys4] Sarafotoxin S6c
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H153N27O36S5Masse moléculaire :2,529.87 g/molGLP-2 (rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C166H256N44O56SMasse moléculaire :3,796.22 g/molGastrin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H125N20O31SMasse moléculaire :2,098.22 g/molKinase Domain of Pyruvate Kinase, porcine liver
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H62N12O13PMasse moléculaire :853.88 g/mol[D-Phe7] a-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H109N21O19SMasse moléculaire :1,664.92 g/molBiotin-Gastrin (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C107H140N22O34S2Masse moléculaire :2,342.56 g/molDefensin (human) HNP-2
<p>Catalogue peptide; min. 95% purity</p>Formule :C147H217N43O37S6Masse moléculaire :3,370.94 g/mol[Des-His1, Glu9]-Glucagon (1-29), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C148H221N41O47SMasse moléculaire :3,358.72 g/molBiotin-LC-Kemptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H86N16O12SMasse moléculaire :1,111.39 g/molTNF-α (31-45), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C69H122N26O22Masse moléculaire :1,667.90 g/mol[D-Ala2]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H35N5O7Masse moléculaire :553.6 g/molcAMP Dependent PK Inhibitor (5-22), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H137N29O26Masse moléculaire :1,969.16 g/molp3K, (Lys 58 Lys 60 Lys 63) Ea(52-68)
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H129N23O25Masse moléculaire :1,777.03 g/molBiotin-Kinase Domain of Insulin Receptor (5)
<p>Catalogue peptide; min. 95% purity</p>Formule :C82H124N21O35SMasse moléculaire :1,996.04 g/mol[Pyr4]-MBP (4-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C60H100N20O17Masse moléculaire :1,391.61 g/mol[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
<p>Catalogue peptide; min. 95% purity</p>Formule :C13H24N4O3Masse moléculaire :284.36 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H66N10O18Masse moléculaire :1,023.07 g/molBiotin-Neuropeptide Y (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C199H300N57O60S2Masse moléculaire :4,514.98 g/mol[D-Ser14]-Humanin (HN)
<p>Catalogue peptide; min. 95% purity</p>Formule :C119H204N34O32S2Masse moléculaire :2,687.28 g/molLeucokinin IV
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H52N12O12Masse moléculaire :904.9 g/mol[Tyr11]-Somatostatin
<p>Catalogue peptide; min. 95% purity</p>Formule :C76H102N18O20S2Masse moléculaire :1,651.91 g/molα-Conotoxin GI
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H76N20O18S4Masse moléculaire :1,433.63 g/molPrepro-Nerve Growth Factor (99-115) (mouse)
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H139N27O26Masse moléculaire :2,003.25 g/molKinase Domain of Insulin Receptor (4)
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molCK1tide
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H96N18O27Masse moléculaire :1,549.58 g/molMurine CMV pp 89 (170-174)
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H41N7O7SMasse moléculaire :631.76 g/molScyliorhinin II, amide ,dogfish
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H119N21O26S3Masse moléculaire :1,851.1 g/mol[Lys15]-Amyloid β-Protein (15-21)
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H69N9O8Masse moléculaire :852.10 g/molHistone H1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H101N17O15Masse moléculaire :1,252.53 g/molabII probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H101N19O19SMasse moléculaire :1,460.69 g/mol[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H68N14O10Masse moléculaire :1,109.3 g/molAutocamtide-3 [KKALHRQETVDAL]
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H113N21O20Masse moléculaire :1,508.75 g/molP38 (411-425), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H100N16O20Masse moléculaire :1,353.55 g/molSecretin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C130H220N44O40Masse moléculaire :3,039.4 g/molNeuron Specific Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C161H262N52O51S4Masse moléculaire :3,870.44 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H109N17O19SMasse moléculaire :1,464.75 g/molBPDEtide [RKISASEFDRPLR]
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H115N23O20Masse moléculaire :1,574.82 g/molAc-[Nle4,DPhe7] a-MSH (4-10), amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H64N14O10Masse moléculaire :985.12 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H49FN4O14Degré de pureté :Min. 95%Masse moléculaire :876.88 g/mol[Tyr0]-pTH-Related Protein (1-34) (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C189H296N58O50Masse moléculaire :4,180.79 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H52N10O13Masse moléculaire :880.92 g/molConantokin T, Marine snail, Conus tullpa
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H175N31O45SMasse moléculaire :2,683.81 g/molLytic Peptide, SB - 37
<p>Catalogue peptide; min. 95% purity</p>Formule :C188H320N54O45SMasse moléculaire :4,088.94 g/mol[Pyr16]-VIP (16-28) (chicken)
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H113N17O18SMasse moléculaire :1,476.83 g/molOrcokinin
CAS :<p>Orcokinin H-Asn-Phe-Asp-Glu-Ile-Asp-Arg-Ser-Gly-Phe-Gly-Phe is a peptide that was synthesized in the laboratory. It has been shown to have receptor activity and to stimulate locomotor activity in experimental models. Orcokinin H is a member of the family of peptide hormones that are present in mammals. The peptide sequence contains six amino acids, four of which are hydrophobic and two polar, with a single hydroxyl group. These features make this molecule an excellent candidate for use as a model system for studying amyloid protein aggregation and its physiological function.</p>Formule :C67H92N18O23Degré de pureté :Min. 95%Masse moléculaire :1,517.55 g/molAc-Endothelin-1 (16-21), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H59N9O10Masse moléculaire :837.98 g/molβ-Casomorphin (1-4), amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H35N5O5Masse moléculaire :521.62 g/molACTH(4-9), Tyr
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H68N14O12SMasse moléculaire :1,125.28 g/molH-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%[D-Pro10]-Dynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C63H103N21O13Masse moléculaire :1,362.66 g/molRenoguanylin (eel)
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N16O22S4Masse moléculaire :1,599.90 g/molAmyloid Dan Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/molZ-Gly-Val-OH
CAS :<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formule :C15H20N2O5Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :308.33 g/molPRRS-RSAB-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H61N11O18Masse moléculaire :1,020.03 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H191N39O29S2Masse moléculaire :2,600.07 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H178N36O30SMasse moléculaire :2,516.92 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molProsaptide, wild type
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H127N19O25Masse moléculaire :1,658.93 g/mol3/4A, Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Masse moléculaire :810.9 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H74N10O11SMasse moléculaire :915.17 g/molα-Neo-Endorphin Analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O13Masse moléculaire :1,383.68 g/molPKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C92H151N28O32PMasse moléculaire :2,192.39 g/molAGRP (87-132), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C219H339N65O63S11Masse moléculaire :5,243.17 g/molA-A-A-Y-G-G-F-L
<p>Catalogue peptide; min. 95% purity</p>Formule :C37H52N8O10Masse moléculaire :768.87 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H67N13O14Masse moléculaire :1,074.19 g/molCarassin (Carrassius Auratus)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molFmoc-Phe-Pro-OH
CAS :<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>Formule :C29H28N2O5Degré de pureté :Min. 95%Masse moléculaire :484.54 g/molZ-His-Phe-OH
CAS :<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C23H24N4O5Degré de pureté :Min. 95%Masse moléculaire :436.46 g/molFmoc-Ile-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Isocyanomethyl resin (200-400 mesh)
<p>Please enquire for more information about Isocyanomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Couleur et forme :PowderH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS :<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Galacto-RGD trifluoroacetate salt
CAS :<p>Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C34H52N10O12Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :792.84 g/molDynorphin A (2-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molInsulin B (22-25)
CAS :<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C26H35N7O5Degré de pureté :Min. 95%Masse moléculaire :525.6 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C41H43FN4O14Degré de pureté :Min. 95%Masse moléculaire :834.8 g/molTax8, HTLV-1 (12-19)
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H68N8O11Masse moléculaire :957.15 g/mol
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[Tyr1]-δ-Sleep Inducing Peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00855.webp&w=3840&q=75)
![[Lys4] Sarafotoxin S6c](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00293.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Des-His1, Glu9]-Glucagon (1-29), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00740.webp&w=3840&q=75)
![[D-Ala2]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00829.webp&w=3840&q=75)
![[Pyr4]-MBP (4-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00186.webp&w=3840&q=75)
![[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00620.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00713.webp&w=3840&q=75)
![[D-Ser14]-Humanin (HN)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00594.webp&w=3840&q=75)
![[Tyr11]-Somatostatin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00218.webp&w=3840&q=75)
![[Lys15]-Amyloid β-Protein (15-21)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00531.webp&w=3840&q=75)
![[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00356.webp&w=3840&q=75)
![Autocamtide-3 [KKALHRQETVDAL]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00520.webp&w=3840&q=75)
![BPDEtide [RKISASEFDRPLR]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00667.webp&w=3840&q=75)
![Ac-[Nle4,DPhe7] a-MSH (4-10), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00019.webp&w=3840&q=75)
![[Tyr0]-pTH-Related Protein (1-34) (human, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00858.webp&w=3840&q=75)
![[Pyr16]-VIP (16-28) (chicken)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00193.webp&w=3840&q=75)
![[D-Pro10]-Dynorphin A (1-11), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00870.webp&w=3840&q=75)
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00600.webp&w=3840&q=75)
