Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30473 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS :<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Masse moléculaire :555.63β-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H209N41O46Masse moléculaire :3,262.53 g/molβ-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H126N24O21S2Masse moléculaire :1,896.22 g/molHistatin 3 (H3)
<p>Catalogue peptide; min. 95% purity</p>Formule :C178H258N64O48Masse moléculaire :4,062.44 g/molβ-Amyloid (17-21)
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H45N5O6Masse moléculaire :595.75 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C219H365N73O66SMasse moléculaire :5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C65H108N22O16Masse moléculaire :1,453.72 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C205H340N60O53Masse moléculaire :4,493.37 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H71N13O15Masse moléculaire :1,070.18 g/molApelin-15 (63-77)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H135N31O18SMasse moléculaire :1,863.24 g/mol[Tyr15]-ACTH (7-15)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H76N14O11Masse moléculaire :1,109.31 g/mol[Trp11] Neurotensin (8-13)
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H65N13O7Masse moléculaire :840.05 g/molOV-1, Sheep
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H188N34O21Masse moléculaire :2,262.88 g/molβ-Amyloid (17-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS :<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C44H49FN4O14Degré de pureté :Min. 95%Masse moléculaire :876.88 g/molHSV-gB2 (498-505) acetate
CAS :<p>Custom research peptide; min purity 95%.</p>Formule :C41H67N11O13•(C2H4O2)xDegré de pureté :Min. 95%Masse moléculaire :922.06 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C94H150N26O31SMasse moléculaire :2,172.46 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H71N13O14S2Masse moléculaire :1,046.24 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H159N29O31Masse moléculaire :2,311.60 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H137N25O35Masse moléculaire :2,045.16 g/molMMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H63N13O13Masse moléculaire :1,042.14 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H80N12O14Masse moléculaire :1,145.3 g/molβ-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C23H28N4O4Masse moléculaire :424.50 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H43N7O6SMasse moléculaire :701.85 g/mol[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H87N15O22S3Masse moléculaire :1,430.61 g/molAntho-Rwamide I
<p>Catalogue peptide; min. 95% purity</p>Formule :C31H46N10O7Masse moléculaire :670.79 g/molFMRF-related peptide, SDPFLRF-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H61N11O10Masse moléculaire :880.02 g/molSomatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H105N23O21SMasse moléculaire :1,528.72 g/mol[Gln11]-β-Amyloid (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C194H296N54O57SMasse moléculaire :4,328.91 g/molFmoc-Homoarg (Z)2-OH
CAS :<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C38H38N4O8Degré de pureté :Min. 95%Masse moléculaire :678.73 g/molCorticostatin, rabbit
<p>Catalogue peptide; min. 95% purity</p>Formule :C163H265N63O44S6Masse moléculaire :4,003.66 g/molKinase Domain of Insulin Receptor (1)
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H105N18O25PMasse moléculaire :1,629.72 g/mol[Arg8]-Vasotocin
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H67N15O12S2Masse moléculaire :1,050.23 g/molAdrenomedullin (13-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C200H308N58O59S2Masse moléculaire :4,533.17 g/molACTH (18-39) (human) (Adrenocorticotropic Hormone) (Biotin)
<p>Catalogue peptide; min. 95% purity</p>Formule :C122H179N29O38Masse moléculaire :2,659.89 g/molDelicious Peptide
CAS :<p>Catalogue peptide; min. 95% purity</p>Formule :C34H57N9O16Masse moléculaire :847.88 g/mol[Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[D-Tyr11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formule :C78H121N21O20Masse moléculaire :1,673 g/mol[Gln11]-β-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H210N42O45Masse moléculaire :3,261.54 g/molβ III probe
<p>Catalogue peptide; min. 95% purity</p>Formule :C87H143N27O28S3Masse moléculaire :2,111.45 g/mol[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H82N14O18Masse moléculaire :1,179.31 g/mol[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formule :C73H92N18O16S2Masse moléculaire :1,541.79 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formule :C216H343N67O60Masse moléculaire :4,838.43 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molCDC25C
<p>Catalogue peptide; min. 95% purity</p>Formule :C115H198N40O33SMasse moléculaire :2,701.17 g/molβ-Amyloid (16-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H52N6O6Masse moléculaire :652.84 g/molMyristoylated ADP-Ribosylation Factor 1, myr-ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H157N21O22Masse moléculaire :1,993.49 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H91N17O15Masse moléculaire :1,254.47 g/molβ-Interleukin II (44-56)
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H113N19O19Masse moléculaire :1,500.77 g/mol[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H59N11O9SMasse moléculaire :858.04 g/molGalanin (1-13)-Spantide I
<p>Catalogue peptide; min. 95% purity</p>Formule :C138H199N35O30Masse moléculaire :2,828.34 g/molBTK derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C72H115N17O18S2Masse moléculaire :1,570.95 g/molOV-2, Sheep
<p>Catalogue peptide; min. 95% purity</p>Formule :C84H159N29O14Masse moléculaire :1,799.39 g/molSaposin C22
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H196N28O37SMasse moléculaire :2,607.02 g/mol2B-(S)
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H138N28O29SMasse moléculaire :2,000.24 g/mol[Pro18, Asp21] β-Amyloid (17-21), iAb5
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H43N5O8Masse moléculaire :637.74 g/molAcetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H61N114O8S2Masse moléculaire :912.15 g/molFibronectin Analog
<p>Catalogue peptide; min. 95% purity</p>Formule :C29H51N11O11Masse moléculaire :729.80 g/molMelanotan II, MT-Ⅱ
<p>Catalogue peptide; min. 95% purity</p>Formule :C50H69N15O9Masse moléculaire :1,024.2 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C39H68N16O11Masse moléculaire :937.08 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H51N9O8Masse moléculaire :725.85 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H343N61O66SMasse moléculaire :5,002.69 g/mol234 CM
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H69N11O14S3Masse moléculaire :1,048.26 g/molP75-TNFR Fragment
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H85N15O15SMasse moléculaire :1,204.42 g/mol[Asp5,6,Me-Phe8] Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C40H56N8O11SMasse moléculaire :857.00 g/mol[D-Met2,Pro5] Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C30H40N6O6SMasse moléculaire :612.75 g/molMating Factor aSK2
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H106N18O19SMasse moléculaire :1,667.92 g/molAmyloid β-Protein (6-20)
<p>Catalogue peptide; min. 95% purity</p>Formule :C86H119N23O23Masse moléculaire :1,843.05 g/molPDGF β-Receptor (739-746) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H62N9O18PSMasse moléculaire :1,116.14 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H67N9O12Masse moléculaire :890.06 g/molBiotin-PACAP (1-38), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C203H331N63O53S1Masse moléculaire :4,534.24 g/molA-18-F-NH2
<p>Catalogue peptide; min. 95% purity</p>Formule :C89H130N24O24Masse moléculaire :7,488 g/molWWamide-3
<p>Catalogue peptide; min. 95% purity</p>Formule :C46H66N12O9SMasse moléculaire :963.18 g/molRES-701-1
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H117N23O24Masse moléculaire :2,061.22 g/molCorticostatin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H261N49O43S6Masse moléculaire :3,715.47 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C27H41N9O8Masse moléculaire :619.7 g/molproPT28
<p>Catalogue peptide; min. 95% purity</p>Formule :C149H248N50O39Masse moléculaire :3,363.95 g/molAc-Amyloid β-Protein (15-20) amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C42H63N9O8Masse moléculaire :822.03 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/molKetolide resistance Peptide MRFFV
<p>Catalogue peptide; min. 95% purity</p>Formule :C34H50N8O6SMasse moléculaire :698.9 g/molα-Melanocyte Stimulating Hormone (11-13)(MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C16H31N5O3Masse moléculaire :341.46 g/mol[D-Ala2] Deltorphin I
<p>Catalogue peptide; min. 95% purity</p>Formule :C37H52N8O10Masse moléculaire :768.87 g/molHIV-gp41-Antigenic Peptide 5
<p>Catalogue peptide; min. 95% purity</p>Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molH-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH
CAS :<p>Please enquire for more information about H-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C72H97N17O16SDegré de pureté :Min. 95%Masse moléculaire :1,488.71 g/molBid BH3
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H127N29O24SMasse moléculaire :1,839.08 g/molPannexin-1 Fragment (4512)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N18O24Masse moléculaire :1,391.47 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formule :C22H36N8O11Masse moléculaire :588.58 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS :<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H81N13O14SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,060.27 g/molAc-Choline Receptor α1(129-145)
<p>Catalogue peptide; min. 95% purity</p>Formule :C90H136N22O28S2Masse moléculaire :2,038.34 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS :<p>L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.</p>Formule :C30H62N10O6Degré de pureté :Min. 95%Masse moléculaire :658.88 g/molGlycoprotein IIb Fragment (656-667)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H90N18O18SMasse moléculaire :1,347.53 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molBiotin-Atrial Natriuretic Peptide (1-28), human, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C137H217N47O41S4Masse moléculaire :3,306.73 g/molH-Leu-NHOH·TFA
CAS :<p>H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.</p>Formule :C6H14N2O2·C2HF3O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :260.21 g/molH-D-Arg(Mtr)-OH
CAS :<p>H-D-Arg(Mtr)-OH is a biochemical that is used for the deprotection of prohormones. H-D-Arg(Mtr)-OH has been shown to have an interaction with peptidyl residues, which modulates their activity. H-D-Arg(Mtr)-OH also modulates the allosteric activity of fibrinogen and thrombin receptor. The use of this chemical in solid phase synthesis provides a way to synthesize peptides on a solid support, such as indole rings, amino acids, or nucleotides. The chemical can be used in the hplc system to determine the concentration of small molecules in solution by measuring the peak area.</p>Formule :C16H26N4O5SDegré de pureté :Min. 95%Masse moléculaire :386.47 g/molgp100 (639-647)
<p>Catalogue peptide; min. 95% purity</p>Formule :C47H79N15O11S2Masse moléculaire :1,094.36 g/molH-Asp-NH2
CAS :<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>Formule :C4H8N2O3Degré de pureté :Min. 95%Masse moléculaire :132.12 g/molBoc-Cys(SO3H)-OH·disodium salt
CAS :<p>Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C8H13NNa2O7S2Masse moléculaire :345.3 g/mol
![[Tyr15]-ACTH (7-15)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00398.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00264.webp&w=3840&q=75)
![[Gln11]-β-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Arg8]-Vasotocin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00302.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[Gln11]-β-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00712.webp&w=3840&q=75)
![[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00275.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00876.webp&w=3840&q=75)
![[Pro18, Asp21] β-Amyloid (17-21), iAb5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00575.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Asp5,6,Me-Phe8] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00320.webp&w=3840&q=75)
![[D-Met2,Pro5] Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00841.webp&w=3840&q=75)
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Ala2] Deltorphin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00825.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
