Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29599 produits trouvés pour "Peptides"
HBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formule :C46H75N9O11S2Masse moléculaire :994.28 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formule :C46H68N10O14SMasse moléculaire :1,017.17 g/molPrepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formule :C118H182N32O32Masse moléculaire :2,560.96 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formule :C176H251N43O53SMasse moléculaire :3,849.30 g/molBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formule :C130H221N37O35SMasse moléculaire :2,894.43 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formule :C147H227N39O43SMasse moléculaire :3,260.75 g/molGAP 26 trifluoroacetate salt
CAS :13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formule :C70H107N19O19SDegré de pureté :Min. 95%Masse moléculaire :1,550.78 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS :Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formule :C33H44N10O7•(HCl)xDegré de pureté :Min. 95%Masse moléculaire :692.77 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formule :C28H45N7O9Masse moléculaire :623.71 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS :Catalogue peptide; min. 95% purity
Formule :C121H193N33O30SMasse moléculaire :2,638.15 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formule :C23H28N4O4Masse moléculaire :424.50 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formule :C104H159N29O31Masse moléculaire :2,311.60 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Formule :C58H77N13O10Masse moléculaire :1,116.34 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C66H109N23O23Masse moléculaire :1,592.74 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formule :C112H197N39O30Masse moléculaire :2,570 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Formule :C22H26N4O6Masse moléculaire :442.48 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H243N41O31Masse moléculaire :3,080.83 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formule :C15H28N4O5Masse moléculaire :344.41 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formule :C59H104N22O20Masse moléculaire :1,441.62 g/molGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formule :C54H89N13O13SMasse moléculaire :1,159.45 g/molH-Asp-NH2
CAS :H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formule :C4H8N2O3Degré de pureté :Min. 95%Masse moléculaire :132.12 g/molRef: 3D-FA107876
Produit arrêtéBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formule :C62H101N17O19Masse moléculaire :1,388.58 g/molZ-Ile-Trp-OH
CAS :Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C25H29N3O5Degré de pureté :Min. 95%Masse moléculaire :451.51 g/molH-Thr-Asp-OH TFA salt
CAS :Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H14N2O6C2F3HO2Degré de pureté :Min. 95%Masse moléculaire :348.23 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formule :C35H41N5O12Masse moléculaire :723.7 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molBoc-D-Glu-OEt·DCHA
CAS :Produit contrôléPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H21NO6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :456.62 g/molBCIP dipotassium
CAS :BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formule :C8H4BrClK2NO4PDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :402.65 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H24N2O6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :497.67 g/molBoc-D-His(Boc)-OH benzene solvate
CAS :Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C16H25N3O6Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :355.39 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formule :C40H52N10O13Masse moléculaire :880.92 g/molbeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formule :C86H151N31O26S2Masse moléculaire :2,099.48 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formule :C61H105N23O21SMasse moléculaire :1,528.72 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formule :C28H38N6O6SMasse moléculaire :586.72 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formule :C93H159N35O25Masse moléculaire :2,167.52 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formule :C36H49N7O7SMasse moléculaire :723.91 g/molMastoparan 7
Catalogue peptide; min. 95% purity
Formule :C67H124N18O15Masse moléculaire :1,421.85 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formule :C143H226N38O39SMasse moléculaire :3,133.71 g/molTyr-Leptin (26-39) (human)
CAS :Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C54H79N13O17Masse moléculaire :1,182.31 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formule :C72H122N21O29SMasse moléculaire :1,777.92 g/molBiotin-Gastrin Releasing Peptide, human
Catalogue peptide; min. 95% purity
Formule :C140H218N40O33S3Masse moléculaire :3,085.74 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Formule :C50H86N22O17Masse moléculaire :1,267.38 g/molγ-TAC4 (32-50)
Catalogue peptide; min. 95% purity
Formule :C92H146N24O31Masse moléculaire :2,084.33 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formule :C59H86N16O15Masse moléculaire :1,259.44 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formule :C72H110N19O33Masse moléculaire :1,862.77 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formule :C66H102N20O13Masse moléculaire :1,383.68 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formule :C135H221N45O33Masse moléculaire :3,002.55 g/molBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C172H276N52O54S3Masse moléculaire :4,032.63 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formule :C35H60N12O7Masse moléculaire :760.94 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formule :C116H190N32O35SMasse moléculaire :2,625 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formule :C52H84N14O21Masse moléculaire :1,241.33 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formule :C53H84N12O16Masse moléculaire :1,145.33 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formule :C35H41N11O7Masse moléculaire :727.79 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formule :C171H271N51O54S2Masse moléculaire :3,969.50 g/molPRRS-RSAB-C
Catalogue peptide; min. 95% purity
Formule :C77H102N20O23Masse moléculaire :1,675.79 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formule :C96H156N34O31SMasse moléculaire :2,314.59 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formule :C63H98N18O13SMasse moléculaire :1,347.66 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formule :C72H108N19O27Masse moléculaire :1,702.77 g/molProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formule :C103H156N32O25Masse moléculaire :2,242.59 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formule :C33H47N9O8SMasse moléculaire :729.86 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formule :C145H210N42O45Masse moléculaire :3,261.54 g/molBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formule :C64H114N22O12Masse moléculaire :1,383.76 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formule :C107H141N22O37PS2Masse moléculaire :2,422.53 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
