Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30318 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Proadrenomedullin (45-92), human
CAS :Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.Formule :C215H359N67O73S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :5114.76Adrenomedullin (AM) (1-52), human
CAS :Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Formule :C264H406N80O77S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :6028.82Substance P acetate
Substance P acetate is a peptide mainly secreted by neurons and is involved in many biological processes including nociception and inflammation.Formule :C65H102N18O15SDegré de pureté :98.81%Couleur et forme :SolidMasse moléculaire :1407.68α-Conotoxin Vc1.1 TFA
α-Conotoxin Vc1.1 TFA is a peptide isolated from Conus victoriae and is also a nAChR antagonist that can be used to study neuropathic chronic pain.Formule :C73H108F3N23O27S4Degré de pureté :97.57%Couleur et forme :SolidMasse moléculaire :1925.03Human PD-L1 inhibitor V
CAS :Human PD-L1 Inhibitor V is a peptide that binds to the human PD-1 protein with an affinity characterized by a dissociation constant (Kd) of 3.32 μM, effectivelyFormule :C65H104N20O18SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1485.71Jingzhaotoxin-XII
<p>Jingzhaotoxin-XII (JzTx-XII) functions as a potent inhibitor of the Kv4.1 channel, exhibiting an inhibitory concentration (IC50) of 0.363 μM.</p>Formule :C161H227N41O44S7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3665.23PTPσ Inhibitor, ISP
PTPσ Inhibitor ISP is a compound that binds to recombinant human PTPs, thereby inhibiting PTPσ signaling.Formule :C177H306N66O54S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4318.93kCAL01
CAS :kCAL01 is a CAL inhibitor with a Ki value of 2.3 μM and holds potential for research in cystic fibrosis (CF).Formule :C36H57N11O9Couleur et forme :SolidMasse moléculaire :787.91p21PBP
p21PBP, a peptide composed of 20 amino acids, serves as an inhibitor of DNA replication. It specifically binds to the purified proliferating cell nuclear antigen (PCNA) found in extracts from tumor cells. p21PBP holds potential for use in cancer research.Formule :C112H181N37O30SCouleur et forme :SolidMasse moléculaire :2557.93PIC1 PA
CAS :PIC1 PA, a peptide consisting of 15 amino acids, serves as an effective analog of PIC1 that inhibits complement activation mediated by the classical pathway. Functionally, PIC1 PA interferes with the interaction between the C1s-C1r-C1r-C1s/MASPs and the collagen-like region (CLR) of C1q/MBL. It specifically binds to the CLR of C1q, with an average equilibrium dissociation constant (KD) of 33.3 nM when binding purified C1q.Formule :C71H123N19O21S2Couleur et forme :SolidMasse moléculaire :1642.98Aam-KTX
Aam-KTX, a toxic peptide sourced from Mesobuthus eupeus scorpion venom, acts as a selective K_v channel inhibitor, exhibiting IC_50 values of 1.1 nM for K_v1.3Formule :C174H288N58O48S7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4184.96Acetyl tetrapeptide-15 Acetate
Acetyl tetrapeptide-15 Acetate (Skinasensyl Acetate) is a peptide used in cosmeceuticals for sensitive skin to study inflammatory and neuropathic pain.Formule :C36H43N5O8Degré de pureté :98.97%Couleur et forme :SolidMasse moléculaire :673.76IGF-I (24-41) TFA (135861-49-3 free base)
IGF-I (24-41) (TFA) is a fragment of IGF-I with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.Formule :C88H133N27O28·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2131.18NFAT Inhibitor acetate
NFAT Inhibitor acetate (VIVIT peptide acetate) is a NFAT peptide inhibitor of calmodulin phosphatase-mediated NFAT dephosphorylation.Formule :C77H122N20O24SDegré de pureté :99.66%Couleur et forme :SolidMasse moléculaire :1743.98RYTVELA TFA
CAS :RYTVELA TFA is a variant interleukin-1 receptor inhibitor with anti-inflammatory activity for the prevention of preterm labor and fetal protection.Formule :C38H62N10O12Couleur et forme :SolidMasse moléculaire :850.96KKI-5 TFA(97145-43-2 free base)
KKI-5 (TFA) is a specific tissue kallikrein inhibitor.Kki-5 (TFA) can reduce breast cancer cell infiltration.Formule :C37H56F3N11O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :887.9Pentasarcosyl angiotensin II
CAS :Pentasarcosyl angiotensin II is a synthetic analog of angiotensin II.Formule :C65H96N18O17Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1401.57Fibrinopeptide A, human
CAS :Human Fibrinopeptide A: 16-residue peptide from fibrinogen's Aα region, cleaved by thrombin.Formule :C63H97N19O26Degré de pureté :98%Couleur et forme :White Lyophilized PowderMasse moléculaire :1536.56Valylvaline
CAS :Valylvaline (Val-val) is a dipeptide compound that can be used for protein synthesis.Formule :C10H20N2O3Degré de pureté :99.67%Couleur et forme :SolidMasse moléculaire :216.28BDS I
Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels.Formule :C210H297N57O56S6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4708.37Lipoxygenase
CAS :Lipoxygenase (LOX) is a dioxygenase that catalyzes the peroxidation of linoleic acid (LA) or arachidonic acid (AA) in the presence of molecular oxygen.Couleur et forme :SolidEnhanced Green Fluorescent Protein (EGFP) (200-208)
CAS :Enhanced Green Fluorescent Protein (200-208) (EGFP (200-208)) is a peptide that strongly binds to H2-K, a restricted cytotoxic T lymphocyte (CTL) epitope.Formule :C45H70N12O15Degré de pureté :98.54% - 99.85%Couleur et forme :SolidMasse moléculaire :1019.11Maurocalcine TFA
Maurocalcine TFA acts as an agonist for ryanodine receptor (RyR) channels 1, 2, and 3, demonstrating cell-penetrating capabilities. It induces binding of [3H]ryanodine to RyR1 with an EC50 of 2558 nM and exhibits an apparent affinity of 14 nM for RyR2. This compound is applicable for in vivo cell tracking or other cellular imaging techniques.Formule :C156H270N56O46S6·xC2HF3O2Couleur et forme :SolidMasse moléculaire :3858.55 (free base)TKD (450-463)
CAS :TKD (450-463), a 14-peptide (TKDNNLLGRFELSG), exhibits the ability to stimulate NK cells' cytolytic and proliferative activities at concentrations comparable to the full-length Hsp70 protein.Formule :C67H110N20O23Couleur et forme :SolidMasse moléculaire :1563.716-FAM-AEEAC-SHK TFA
<p>6-FAM-AEEAC-SHK TFA, a peptide neurotoxin derived from Stichodactyla helianthus and conjugated with a fluorescent marker, selectively blocks voltage-gated potassium channels (kv1.1 and kv1.2). By prolonging action potentials, it interferes with neural signal conduction, making it valuable in neuroscience research.</p>Formule :C196H295N55O57S7·xCHF3O2Couleur et forme :SolidMasse moléculaire :4558.23 (free acid)EC-1456
CAS :<p>EC-1456 is a folate-microtubule targeting agent that exhibits significant antiproliferative activity against folate receptor (FR) positive tumors, including models resistant to anticancer drugs. EC-1456 is utilized in cancer research.</p>Formule :C110H165N23O45S3Couleur et forme :SolidMasse moléculaire :2625.81Rink Amide MBHA resin (100 - 200 mesh); loading 0.54 mmol/g
CAS :Couleur et forme :White to light-yellow or beige beadsMasse moléculaire :-CAY10679
CAS :CAY10679, an anionic oligopeptide-based bola-amphiphile, features a central hexane segment bordered by a glycylglycine group at each end, establishing pronounced hydrophilic and hydrophobic regions. This amphiphilic peptide's propensity for self-assembling into microtubes in aqueous acidic solutions has been explored. Such bola-amphiphiles hold significant potential in the development of nanotubes, nanovesicles, nanowires, and nanocarriers for drug delivery, among various bionanotechnology applications.Formule :C16H26N4O8Couleur et forme :SolidMasse moléculaire :402.404N-Oleoyl Valine Ammonium salt
N-Oleoyl Valine Ammonium salt is an N-acyl amide compound that is a TRPV3 antagonist and can be used to study inflammation.Formule :C23H46N2O3Degré de pureté :99.72%Couleur et forme :SolidMasse moléculaire :398.62Leu-Leu methyl ester hydrobromide
CAS :Formule :C13H26N2O3·HBrDegré de pureté :(TLC) ≥ 99.0%Couleur et forme :White powderMasse moléculaire :339.27Nucleoprotein (118-126)
CAS :Nucleoprotein (118-126),a fragment of Nucleoprotein, is a 9-aa peptide .Formule :C43H69N13O13SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1008.15Bis(tetramethylene)fluoroformamidinium hexafluorophosphate
CAS :Formule :C9H16F7N2PMasse moléculaire :316.20µ-Conotoxin-CnIIIC acetate
µ-Conotoxin-CnIIIC acetate is a NaV1.4 sodium channel antagonist, a conotoxin peptide consisting of 22 amino acids, used for muscle relaxation and pain relief.Formule :C92H139N35O28S6·xC2H4O2Degré de pureté :99.94%Couleur et forme :SolidMasse moléculaire :2375.70 (free base)IRL-1620 TFA (142569-99-1 free base)
<p>IRL-1620 (TFA) is a potent selective endothelin receptor B (ETB) agonist with a Ki value of 16pm.</p>Formule :C88H118F3N17O29Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1934.97CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formule :C162H262N50O52S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3806.3Val-Lys(Boc)-PAB
CAS :Val-Lys(Boc)-PAB, an ADC linker, facilitates the synthesis of camptothecin peptide conjugates as antitumor agents and serves as a non-linear self-immolative linker to lessen the hydrophobicity of antibody-drug conjugates in cancer therapy.Formule :C23H38N4O5Couleur et forme :SolidMasse moléculaire :450.58Rhodopsin peptide
Rhodopsin peptide: H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW=1217.33; light-sensitive, linked to retinopathies.Formule :C51H88N14O20Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1217.33Pep1-TGL
Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunitFormule :C41H71N11O15SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :990.14Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3692.15Palmitoyl dipeptide-7
CAS :Palmitoyl dipeptide-7 is a peptide.Formule :C26H51N3O5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :485.7Locustapyrokinin II
CAS :Locustapyrokinin II is a member of the FXPRL-amide peptide family isolated from Locusta migratoria.Formule :C65H98N16O17Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1375.594Fibronectin Active Fragment Control acetate
Fibronectin Active Fragment Control acetate is an active fragment of fibronectin which is a glycoprotein.Formule :C20H36N8O11Degré de pureté :98.18%Couleur et forme :SolidMasse moléculaire :564.55Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS :Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Formule :C32H45N9O10SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :747.82Mas7
CAS :<p>Amphiphilic peptide Mas7, a structural analogue of mastoparan is a known activator of heterotrimeric Gi-proteins and its downstream effectors.</p>Formule :C67H124N18O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1421.81TBTU
CAS :Formule :C11H16BF4N5ODegré de pureté :≥ 99.0%Couleur et forme :White to almost white powderMasse moléculaire :321.08Tetrapeptide-3
CAS :Tetrapeptide-3 is a bioactive chemical.Formule :C20H37N9O4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :467.57LAH4 acetate
<p>LAH4 acetate is the α-helical structure of the designed amphoteric peptide antibiotic, which is capable of complexing DNA, associating with the cell surface</p>Formule :C134H232N38O29Degré de pureté :98.41%Couleur et forme :SoildMasse moléculaire :2839.51matrix protein (3-15) [Zaire ebolavirus]
Matrix protein (3-15) links viral envelope to ebolavirus core; part of EBOV, a Filoviridae causing fatal hemorrhagic fevers.Formule :C69H110N16O20SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1515.77Neuromedin U, rat TFA (117505-80-3 free base)
Neuromedin U, rat TFA is a 23-amino acid brain-gut peptide.Formule :C126H181N34F3O33Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2756.99Gp100 (619-627)
CAS :This is a HLA-A*0201 restricted epitope used in melanoma studies.Formule :C49H82N14O14SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1123.336-CR110, SE [6-Carboxyrhodamine 110, succinimidyl ester]*Single isomer*
6-CR110, SE [6-Carboxyrhodamine 110, succinimidyl ester]*Single isomer* is a Fluorescein for peptide and oligonucleotide labeling.Formule :C25H18ClN3O7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :523.92Knqdk peptide
CAS :Knqdk peptide is a synthetic pentapeptide, located in residues 112-116 of bovine K-casein.Formule :C25H45N9O10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :631.68type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Formule :C47H77N13O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1064.19C111 Peptide
CAS :C111 Peptide is a peptide.Formule :C33H49N9O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :699.8β-catenin peptide
CAS :<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Formule :C49H76N12O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1073.2Crustacean Cardioactive Peptide Acetate
CCAP acetate, a widespread neuropeptide in arthropods, is a cyclic hormone produced in insect neurons.Formule :C44H62N10O14S2Degré de pureté :99.56%Couleur et forme :SolidMasse moléculaire :1019.15AtPep3 TFA (902781-14-0 free base)
AtPep3 TFA is a hormone-like peptide that plays a role in the salinity stress tolerance of plants.Formule :C104H179N36F3O34Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2534.75MAGE-A3 (195-203)
CAS :MAGE-3/HLA-A24 is a strong MHC-binding peptide, promising for immunotherapy in MAGE-3+ tumors.Formule :C45H82N10O10SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :955.3Boc-Gly-Gly-Phe-Gly-OH TFA(187794-49-6,free)
Boc-Gly-Gly-Phe-Gly-OH TFA is a self-assembly of N-protected and C-protected tetrapeptides and is a protease cleaved connector for antibody-drug binding (ADC).Formule :C22H29F3N4O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :550.48β-Amyloid(1-14),mouse,rat
<p>Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide. This peptide is amino acids 1 to 14 fragment of Beta-Amyloid peptide.</p>Formule :C69H95N21O24Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1603.7Leu-Val
CAS :Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.Formule :C11H22N2O3Degré de pureté :99.32%Couleur et forme :SolidMasse moléculaire :230.3G280-9
CAS :G280-9 peptide: melanoma epitope for HLA-A2; recognized by T cells at low levels; low immunogenicity due to weak HLA-A2 affinity.Formule :C44H67N9O14Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :946.05[Pro3]-GIP (Rat)
<p>Rat GIP receptor partial agonist with Kd of 13 nM, boosts cAMP in COS-7 cells, competitively antagonizes GIP.</p>Formule :C226H343N61O64SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4970.63Peptide YY (PYY) (3-36), human TFA
Peptide YY (PYY) (3-36), human (TFA) is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite[1].Formule :C176H272N52O54·C2HF3O2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :4094.44Super Fluor 750, SE
Super Fluor 750, SE: a dye for labeling antibodies, proteins, tracers, optimized for cell detection.Degré de pureté :98%Couleur et forme :SolidWL47 TFA
WL47 TFA is a selective small molecule caveolin-1 oligomer disruptor that disrupts CAV1 oligomers.Formule :C76H119F3N22O18S4Degré de pureté :99.80%Couleur et forme :SolidMasse moléculaire :1814.16SV40 T-Ag-derived NLS peptide
CAS :This peptide, a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.Formule :C66H111N19O18SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1490.77Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
Blocker of bovine endothelial NOS (599-613), inhibits NO production, useful in managing ischemic injury and inflammation.Formule :C85H127N25O27SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1963.13RLLFT-NH2
CAS :TFLLR-NH2, reversed amino acid sequence control peptide, is a PAR1 selective agonist that significantly increases the nociceptive threshold.Formule :C31H53N9O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :647.81Acetyl tetrapeptide-9
CAS :Acetyl tetrapeptide-9 is important for the stimulation of basement membrane polysaccharide (lumican) and the synthesis of collagen I.Formule :C22H33N7O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :539.54Acth (7-16)NH2
CAS :Acth (7-16)NH2 exhibits neurotrophic effects.Formule :C58H92N18O10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1201.47Skeletal muscle-targeted peptide MSP
CAS :Skeletal muscle-targeted peptide MSP, a muscle-targeting peptide (MTP) composed of seven amino acids (ASSLNIA), selectively binds to various ligands in muscle tissues. This targeting capability makes it a useful tool in researching cardiac and skeletal muscle diseases.Formule :C28H50N8O11Couleur et forme :SolidMasse moléculaire :674.74Thioredoxin reductase peptide TFA
Thioredoxin reductase peptide TFA corresponds to residues 53-67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research..Formule :C68H107F3N18O20S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1617.81Ac-VDQQD-pNA
CAS :Ac-VDQQD-pNA serves as a substrate for Caspase 2, which cleaves it to yield the yellow compound pNA (p-nitroaniline).Formule :C31H43N9O14Couleur et forme :SolidMasse moléculaire :765.73SN50 TFA
SN50 TFA is an inhibitor of NF-κB and attenuates alveolar hypercoagulation and fibrinolysis inhibition. SN50 TFA can be used in studies about ARDS.Formule :C129H230N36O29S·XCF3COOHCouleur et forme :SolidMasse moléculaire :2781.5 (free base)ACTH (1-14) TFA (25696-21-3 free base)
ACTH (1-14) (TFA) is a polypeptide of corticotrophin, which promotes the release of cortisol.Formule :C79H110F3N21O22SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1794.9NY-BR-1 p904 (A2)
CAS :T-cell clones specific for this NY-BR-1 epitope (p904) can recognize breast tumor cells expressing NY-BR-1.Formule :C43H78N10O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :975.14Bacterial Sortase Substrate III, Abz/DNP (TFA)
<p>Abz/DNP TFA is a quenched fluorescent peptide, cleaved by SrtA in Staphylococcus aureus, forming amide bonds in cell walls.</p>Formule :C43H58N11F3O16Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1042.02Leucokinin VIII
Leucokinin VIII is an diuretic octapeptide isolated form head extracts of the cockroach.Formule :C42H52N10O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :872.92α-Conotoxin GI acetate
α-Conotoxin GI acetate is a competitive antagonist of the muscle-type nicotinic acetylcholine receptors (nAChR).Formule :C57H84N20O20S4Degré de pureté :96.49%Couleur et forme :SolidMasse moléculaire :1497.66Cortistatin-14 TFA (186901-48-4 free base)
Cortistatin-14 is a neuropeptide have structural similarity to somatostatin-14. It is produced in the cortex and hippocampus of central nervous system.Formule :C83H115F3N20O20S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1834.05Krds peptide
CAS :Krds, a synthetic tetrapeptide from lactotransferrin residues 39-42, inhibits monoclonal antibody binding to GPIIb-IIIa in platelets and megakaryocytes.Formule :C19H36N8O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :504.54Lamin fragment
Lamin: α-helical, intermediate filament protein; key in nuclear lamina structure & nuclear functions; sequence: Lys-Ala-Gly-Gln-Val-Val-Thr-Ile-Trp.Formule :C47H76N12O12Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1001.18H-Leu-Leu-OMe . HBr
H-Leu-Leu-OMe·HBr, a dipeptide by monocytes, stresses endolysosomal pathways, targeting cytotoxic lymphocytes.Formule :C15H31BrN2O5Degré de pureté :98.91%Couleur et forme :SolidMasse moléculaire :399.32Arfalasin
CAS :Arfalasin is a bioactive chemical.Formule :C48H67N13O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1002.13C112 Peptide
CAS :C112 Peptide is a novel peptide.Formule :C27H49N9O7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :611.73survivin (baculoviral IAP repeat-containing protein 5) (21-28)
Survivin, often up-regulated in tumors, inhibits apoptosis and regulates mitosis, linking high levels to poor cancer prognosis.Formule :C54H73N11O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1052.22β-Endorphin, equine (TFA)
β-Endorphin, equine (TFA) is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors.Formule :C156H249F3N42O46SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3537.96M-2420
CAS :<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Formule :C70H91N15O27Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1574.56Rac1 Inhibitor F56, control peptide
CAS :Control peptide version of Rac1 Inhibitor; comprises residues 45-60 of Rac1 with Trp56 replaced by Phe. Does not affect GEF-Rac1 interaction.Formule :C72H116N18O23SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1632.89Acv tripeptide
CAS :Acv tripeptide is a crucial precursor in penicillin and cephalosporin biosyntheses.Formule :C14H25N3O6SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :363.43Locustatachykinin I
CAS :Insect tachykinin-related peptide (TRP)Formule :C43H63N13O11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :938.04α1BAla
CAS :alpha1BAla is a partially alpha-helical peptide.Formule :C70H121N21O25SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1688.9P110
CAS :Drp1 inhibitor blocks its GTPase, preserves mitochondrial function, and reduces ROS and cell death, aiding Parkinson's model.Formule :C100H179N45O25Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2411.8Sarasinoside B1
CAS :Sarasinoside B1 is a norlanostane-triterpenoid oligoglycoside from the Palauan marine sponge Asteropus sarasinosum.Formule :C61H98N2O25Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1259.444[Des-octanoyl]-Ghrelin (rat)
CAS :[Des-octanoyl]-Ghrelin (rat) is a Non-acylated, major circulating isoform of ghrelin.Formule :C139H231N45O41Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3188.6Maraciclatide
CAS :Maraciclatide is a radiopharmaceutical targeting αvβ3 integrin.Formule :C72H120N20O21S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1698.05Neuropeptide Y (29-64), amide, human TFA
Neuropeptide Y (29-64), human TFA, guards neurons against Alzheimer's and β-Amyloid toxicity.Formule :C191H286F3N55O59SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :4385.7Super Fluor 555, SE
Super Fluor 555, SE, a bright, photostable dye for proteins and antibodies, enables sensitive cellular detection without self-quenching.Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/A
![matrix protein (3-15) [Zaire ebolavirus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2184.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![[Des-octanoyl]-Ghrelin (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2242.webp&w=3840&q=75)
