Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29799 produits trouvés pour "Peptides"
beta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS :Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formule :C54H103NO7SDegré de pureté :Min. 95%Masse moléculaire :910.46 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formule :C93H159N35O25Masse moléculaire :2,167.52 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formule :C36H49N7O7SMasse moléculaire :723.91 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formule :C66H117N23O13Masse moléculaire :1,440.81 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formule :C66H102N20O13Masse moléculaire :1,383.68 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formule :C79H116N22O17Masse moléculaire :1,645.9 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS :Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H32N4O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :392.49 g/molBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molγ-Bag Cell Peptide
Catalogue peptide; min. 95% purity
Formule :C31H51N11O8Masse moléculaire :705.82 g/molHelodormin
Catalogue peptide; min. 95% purity
Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H24N2O6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :497.67 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formule :C35H60N12O7Masse moléculaire :760.94 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formule :C60H102N16O17Masse moléculaire :1,319.58 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS :Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formule :C33H44N10O7•(HCl)xDegré de pureté :Min. 95%Masse moléculaire :692.77 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Insulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formule :C72H107N19O24Masse moléculaire :1,622.77 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formule :C44H67N15O13S2Masse moléculaire :1,078.25 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formule :C99H153N29O26S5Masse moléculaire :2,325.82 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formule :C157H253N53O42Masse moléculaire :3,555.01 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formule :C59H91N11O15Masse moléculaire :1,194.45 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formule :C72H110N19O33Masse moléculaire :1,862.77 g/molMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS :This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.
Formule :C28H36N6O10Degré de pureté :Min. 95%Masse moléculaire :616.6 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS :Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H63N15O13Degré de pureté :Min. 95%Masse moléculaire :1,082.13 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molH-Asp-NH2
CAS :H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formule :C4H8N2O3Degré de pureté :Min. 95%Masse moléculaire :132.12 g/molRef: 3D-FA107876
Produit arrêtéH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C74H114N28O20Masse moléculaire :1,715.91 g/molAlpha-Dendrotoxin
CAS :Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Formule :C305H472N98O84S6Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :7,048.02 g/molCJC-1295
CAS :CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.
Degré de pureté :Min. 95%Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS :Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formule :C32H50N4O8Degré de pureté :Min. 95%Masse moléculaire :618.76 g/molNps-Val-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C11H14N2O4S·C12H23NDegré de pureté :Min. 95%Masse moléculaire :451.62 g/molAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Formule :C50H72N13O15PMasse moléculaire :1,126.20 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS :Catalogue peptide; min. 95% purity
Formule :C121H193N33O30SMasse moléculaire :2,638.15 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C60H87N19O14Masse moléculaire :1,298.48 g/mol[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formule :C67H118N26O17Masse moléculaire :1,559.85 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formule :C59H89N17O14Masse moléculaire :1,260.47 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formule :C59H97N17O19Masse moléculaire :1,348.53 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS :Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C57H72N14O8Degré de pureté :Min. 95%Masse moléculaire :1,081.27 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS :Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formule :C33H45N6O12PMasse moléculaire :748.8 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formule :C39H68N16O11Masse moléculaire :937.08 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formule :C89H152N22O15Masse moléculaire :1,770.34 g/molFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formule :C16H29N3O6Masse moléculaire :359.43 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formule :C116H190N32O35SMasse moléculaire :2,625 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Formule :C50H86N22O17Masse moléculaire :1,267.38 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C43H47FN4O15Degré de pureté :Min. 95%Masse moléculaire :878.85 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formule :C28H45N7O9Masse moléculaire :623.71 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formule :C59H86N16O15Masse moléculaire :1,259.44 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formule :C40H72N12O13Masse moléculaire :929.09 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formule :C64H114N22O12Masse moléculaire :1,383.76 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Formule :C157H261N49O43S6Masse moléculaire :3,715.47 g/molAmylin (human) trifluoroacetate salt
CAS :Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formule :C165H261N51O55S2Degré de pureté :Min. 95%Masse moléculaire :3,903.28 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formule :C93H136N22O27Masse moléculaire :1,994.25 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/molIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Degré de pureté :Min 85% By Sds-Page.Lys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C56H85N17O13Masse moléculaire :1,204.41 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C23H33N5O9Masse moléculaire :523.55 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formule :C72H122N21O29SMasse moléculaire :1,777.92 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C180H287N57O48Masse moléculaire :4,017.55 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formule :C262H403N79O76S3Masse moléculaire :5,971.67 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formule :C45H82N14O13SMasse moléculaire :1,059.31 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formule :C107H141N22O37PS2Masse moléculaire :2,422.53 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formule :C72H103N19O16SMasse moléculaire :1,522.81 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formule :C116H161N27O32S4Masse moléculaire :2,573.99 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formule :C64H100N18O14Masse moléculaire :1,345.62 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%beta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formule :C133H204N34O37SMasse moléculaire :2,903.38 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
