CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30311 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-GIFPLAER^-OH


    <p>Peptide H-GIFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48996

    ne
    À demander
  • H-SLEDLQLTHNK^-OH


    Peptide H-SLEDLQLTHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43454

    ne
    À demander
  • Ac-VLQWAKKGYYTMKSN-NH2


    Peptide Ac-VLQWAKKGYYTMKSN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45192

    ne
    À demander
  • LCBiot-VYPDHA-OH


    <p>Peptide LCBiot-VYPDHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46487

    ne
    À demander
  • Biotin-BIM α3 (51-76) (His tag) amide


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50333

    ne
    À demander
  • HXB2 gag NO-89/aa353 - 367


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,492.8 g/mol

    Ref: 3D-PP51020

    ne
    À demander
  • H-LPPYLFT-OMe


    <p>Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47972

    ne
    À demander
  • β-Amyloid (4-10)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C39H52N12O12
    Masse moléculaire :880.92 g/mol

    Ref: 3D-PP50022

    ne
    À demander
  • Fmoc-Cys-OH


    Peptide Fmoc-Cys-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44975

    ne
    À demander
  • H-VNLLSAIK^-OH


    <p>Peptide H-VNLLSAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43252

    ne
    À demander
  • Kisspeptin 234

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C63H78N18O13
    Masse moléculaire :1,295.42 g/mol

    Ref: 3D-PP50009

    ne
    À demander
  • H-ATFQTPDFIVPLTDLR^-OH


    Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40915

    ne
    À demander
  • H-STSGGTAALGCLVK^-OH


    Peptide H-STSGGTAALGCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48411

    ne
    À demander
  • Ac-VVVVVVD-OH


    <p>Peptide Ac-VVVVVVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43690

    ne
    À demander
  • 1-Adamantanecarbonyl-Arg-Phe-NH2


    <p>Peptide 1-Adamantanecarbonyl-Arg-Phe-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48311

    ne
    À demander
  • H-GK^GDPK^K^PR-OH


    Peptide H-GK^GDPK^K^PR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41095

    ne
    À demander
  • Ac-NNNN-NH2


    Peptide Ac-NNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48146

    ne
    À demander
  • H-VHGLEIEGR^-OH


    <p>Peptide H-VHGLEIEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41563

    ne
    À demander
  • H-APLQGTLLGYR^-OH


    <p>Peptide H-APLQGTLLGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42739

    ne
    À demander
  • H-KDILEDERAAVDTYC-NH2


    <p>Peptide H-KDILEDERAAVDTYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49747

    ne
    À demander
  • H-DRVYI^HPFHLVI-OH


    <p>Peptide H-DRVYI^HPFHLVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41831

    ne
    À demander
  • Ac-Kpy-NH2


    <p>Peptide Ac-Kpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42781

    ne
    À demander
  • SIVmac239 - 60


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,715.9 g/mol

    Ref: 3D-PP50846

    ne
    À demander
  • H-HLDDLK^^-OH


    <p>Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40095

    ne
    À demander
  • H-DPTFIPAPIQAK^-OH


    <p>Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42197

    ne
    À demander
  • H-YLAEVATGEK^-OH


    <p>Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48747

    ne
    À demander
  • H-ELHHLQEQNVSNA^FLDK^-OH


    <p>Peptide H-ELHHLQEQNVSNA^FLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41121

    ne
    À demander
  • H-YTAGVSPK^-OH


    <p>Peptide H-YTAGVSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41597

    ne
    À demander
  • H-APRWDAPLRDPAL^-OH


    <p>Peptide H-APRWDAPLRDPAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47752

    ne
    À demander
  • Myosin H Chain Fragment(615-630), Mouse


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50838

    ne
    À demander
  • CMVpp65 - 53 (ENTRATKMQVIGDQY)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,754 g/mol

    Ref: 3D-PP50883

    ne
    À demander
  • Ala-Asp-Ser-Asp-Pro-Arg

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C25H41N9O12
    Masse moléculaire :659.65 g/mol

    Ref: 3D-PP50686

    ne
    À demander
  • H-ALEI-NH2


    <p>Peptide H-ALEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48622

    ne
    À demander
  • H-GLNEEIAR^V-OH


    Peptide H-GLNEEIAR^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47562

    ne
    À demander
  • H-VAVVRTPPK^-OH


    <p>Peptide H-VAVVRTPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45840

    ne
    À demander
  • B-Ahx-APRTPGGRR-NH2


    Peptide B-Ahx-APRTPGGRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43263

    ne
    À demander
  • H-IWLDNVR^-OH


    Peptide H-IWLDNVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41025

    ne
    À demander
  • HXB2 gag NO-97/aa385 - 399


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,724.1 g/mol

    Ref: 3D-PP50262

    ne
    À demander
  • PrEST Antigen TAS2R39


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :21 g/mol

    Ref: 3D-PP50580

    ne
    À demander
  • H-VTFSNIK^-OH


    <p>Peptide H-VTFSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40715

    ne
    À demander
  • H-HEIPVLP^NR-OH


    <p>Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47798

    ne
    À demander
  • CMVpp65 - 20 (VQHTYFTGSEVENVS)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,696.8 g/mol

    Ref: 3D-PP51023

    ne
    À demander
  • H-ITLYLK^-OH


    <p>Peptide H-ITLYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45690

    ne
    À demander
  • β-Amyloid (1-38)

    CAS :
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C184H277N51O56S
    Masse moléculaire :4,131.6 g/mol

    Ref: 3D-PP50622

    ne
    À demander
  • Aoa-KDEL-OH


    <p>Peptide Aoa-KDEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44036

    ne
    À demander
  • Ac-VAAWTLKAAA-NH2


    <p>Peptide Ac-VAAWTLKAAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48367

    ne
    À demander
  • Biot-ERGVT-OH


    Peptide Biot-ERGVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46554

    ne
    À demander
  • H-IIPGGIYDADLNDEWVQR^-OH


    Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41205

    ne
    À demander
  • H-GSSDVDQLGK^-OH


    <p>Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49696

    ne
    À demander
  • H-SDGPVKV^-OH


    Peptide H-SDGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47682

    ne
    À demander
  • Apolipoprotein C-III [25-40]


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP51036

    ne
    À demander
  • H-R^PPGFSP-OH


    Peptide H-R^PPGFSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40627

    ne
    À demander
  • H-IALILEPICCQERAA-OH


    <p>Peptide H-IALILEPICCQERAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Formule :C71H123N19O21S2
    Masse moléculaire :1,642.98 g/mol

    Ref: 3D-PP43039

    1mg
    291,00€
    10mg
    347,00€
    100mg
    593,00€
  • H-GAGSSEPVTGLDAK^-OH


    Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48522

    ne
    À demander
  • H-AFYLAGGVPR^-OH


    <p>Peptide H-AFYLAGGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43574

    ne
    À demander
  • HXB2 gag NO-108


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,765.1 g/mol

    Ref: 3D-PP50131

    ne
    À demander
  • Octreotide


    <p>Peptide Octreotide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49921

    ne
    À demander
  • H-FPLTNAIK^-OH


    <p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00163

    ne
    À demander
  • H-STDTAYMELSSLR^-OH


    Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00473

    ne
    À demander
  • H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2


    <p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>
    Formule :C258H401N79O78
    Masse moléculaire :5,857.5 g/mol

    Ref: 3D-PH00214

    ne
    À demander
  • H-TANDLNLLILR^-OH


    <p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00486

    ne
    À demander
  • H-HEAWITLEK^-OH


    Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00226

    ne
    À demander
  • Fmoc-PFAV


    Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PF00002

    ne
    À demander
  • HXB2 gag NO-95/aa377 - 391


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,906.3 g/mol

    Ref: 3D-PP50436

    ne
    À demander
  • H-IVGGWECEK^-OH


    Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00270

    ne
    À demander
  • H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2


    H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C190H288N54O57
    Masse moléculaire :4,240.7 g/mol

    Ref: 3D-PH00028

    ne
    À demander
  • H-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH


    H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C192H295N61O60S
    Masse moléculaire :4,449.9 g/mol

    Ref: 3D-PH00240

    ne
    À demander
  • H-NAVEVLKR^-OH


    Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00364

    ne
    À demander
  • gp100 (86-95)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50508

    ne
    À demander
  • CMVpp65 - 61 (FMHVTLGSDVEEDLT)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,692.9 g/mol

    Ref: 3D-PP50891

    ne
    À demander
  • H-AAGIGILTV^-OH


    Peptide H-AAGIGILTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44948

    ne
    À demander
  • Ac-DEVDAFC-OH


    <p>Peptide Ac-DEVDAFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PA00006

    ne
    À demander
  • Ac-CEPLEKQHEKERKQEEGES


    Ac-CEPLEKQHEKERKQEEGES is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

    Ref: 3D-PA00003

    ne
    À demander
  • H-VAELEHGSSAYSPPDAFK^-OH


    Peptide H-VAELEHGSSAYSPPDAFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00521

    ne
    À demander
  • H-GNDVAFHFNPR^-OH


    <p>Peptide H-GNDVAFHFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00188

    ne
    À demander
  • H-YTIAALLSPYSYSTTAVVTNPK^E-OH


    Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47721

    ne
    À demander
  • H-LSITIRPR^-OH


    Peptide H-LSITIRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00338

    ne
    À demander
  • Fmoc-FAVP


    Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PF00001

    ne
    À demander
  • H-WYQSIR^-OH


    Peptide H-WYQSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00573

    ne
    À demander
  • H-VYIHP^F-OH


    Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45648

    ne
    À demander
  • H-GPSVFPLAPSSR^-OH


    <p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PH00200

    ne
    À demander
  • H-SNLELLR^-OH


    Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00469

    ne
    À demander
  • H-EVTVDTTLAGYHLPK^-OH


    Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00137

    ne
    À demander
  • H-TENNDHINLK^-OH


    <p>Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40373

    ne
    À demander
  • H-GPEQTQGNFGDQELIR^-OH


    Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00192

    ne
    À demander
  • H-TYFPHFDVSHGSAQVK^-OH


    Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00514

    ne
    À demander
  • H-YTPVGR^-OH


    Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00608

    ne
    À demander
  • H-VHLTPE^EKS-OH


    Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00531

    ne
    À demander
  • H-QQTVGGVNYFFDVEVGR^-OH


    <p>Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41201

    ne
    À demander
  • Ac-RERQR-OH


    Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PA00010

    ne
    À demander
  • H-LITTQQWLIK^-OH


    Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00319

    ne
    À demander
  • H-FQTLLALHR^-OH


    Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48734

    ne
    À demander
  • H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2


    H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
    Formule :C194H295N55O57
    Masse moléculaire :4,309.81 g/mol

    Ref: 3D-PH00600

    ne
    À demander
  • Trp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C68H100N18O21
    Masse moléculaire :1,505.63 g/mol

    Ref: 3D-PP50091

    ne
    À demander
  • H-LANDAAQVK^-OH


    <p>Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47408

    ne
    À demander
  • H-NGFFF-NH2


    Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43144

    ne
    À demander
  • H-LPDATPK^-OH


    Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46766

    ne
    À demander
  • H-R^PHFPQFSYSASGTA-OH


    <p>Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48117

    ne
    À demander
  • H-ALSTGEKGFGYK^-OH


    <p>Peptide H-ALSTGEKGFGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41193

    ne
    À demander
  • H-A^^P^^G^^-OH


    Peptide H-A^^P^^G^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49290

    ne
    À demander