Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30306 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-RERQR-OH
Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITTQQWLIK^-OH
Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C194H295N55O57Masse moléculaire :4,309.81 g/molTrp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C68H100N18O21Masse moléculaire :1,505.63 g/molH-ARTKQTARKSTGGKAPRKQLA-NTPEGBiot
<p>Peptide H-ARTKQTARKSTGGKAPRKQLA-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H5N1 Labeled 5-peptide Mixture
<p>Pack contains 100 vials. Peptide sequences:<br>H5N1 labeled seq1 H-IQIIPK^-OH H5N1 labeled seq2 H-LVLATGLR^-OHH5N1 labeled seq3 H-EFNNLER^-OH H5N1 labeled seq4 H-TLDFHDSNVK^-OHH5N1 labeled seq5 H-EEISGVK^-OH R^ = Arginine (U-13C6,15N4)K^ = Lysine (U-13C6,15N2)1nmol/peptide/vial and provided as dry aliquots</p>Degré de pureté :Min 98%H-VVSVLTVLHQDWLNGKEY^K-OH
<p>Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSGFFVFSR^-OH
<p>Peptide H-GSGFFVFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISVYYNEATGGK^^-OH
Peptide H-ISVYYNEATGGK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEDTIFLR^-OH
Peptide H-TEDTIFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein (TIRAP) (Isoform b)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-LCTP^SR-OH
Peptide H-LCTP^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQAEPDNLAR^-OH
Peptide H-IQAEPDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTSANIQEFAGCK^-OH
<p>Peptide H-AVTSANIQEFAGCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TIVGALIQSVK^-OH
Peptide H-TIVGALIQSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 29 (VYALPLKMLNIPSIN)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,686.1 g/molH-WQEEMELYR^-OH
<p>Peptide H-WQEEMELYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVNAAIAAIK^-OH
<p>Peptide H-DVNAAIAAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QKRGR-NH2
Peptide Ac-QKRGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Casein Kinase II Assay Kit
Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C45H73N19O24Masse moléculaire :1,264.2 g/molSIVmac239 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,476.7 g/molFibronectin Active Fragment (RGDS)
CAS :<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>Formule :C15H27N7O8Degré de pureté :Min. 95%Masse moléculaire :433.42 g/molAc-LKISQAPQVSISRSKSYRENGAPFC-NH2
<p>Peptide Ac-LKISQAPQVSISRSKSYRENGAPFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SALVLQYLR^-OH
<p>Peptide H-SALVLQYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SWFR-NH2
<p>Peptide Ac-SWFR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KKLETFSSTN-OH
<p>Peptide Ac-KKLETFSSTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>DTrp-γ MSH
<p>Peptide DTrp-Gamma MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C74H99N21O16SMasse moléculaire :1,570.81 g/mol(2S)-2-[[(2S)-5-Amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutan oyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]acetyl]amino]-5-oxopentanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-(1H-
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C58H78N14O14Masse moléculaire :1,195.35 g/molH-SLLMWITQV^-OH
<p>Peptide H-SLLMWITQV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LWWPD-OH
Peptide Ac-LWWPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYEPLEDPGVK^-OH
<p>Peptide H-SYEPLEDPGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Abz-GIEPFSDPMPEQ-EDDnp
Peptide Abz-GIEPFSDPMPEQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 141
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,782.1 g/molMelanocyte Associated Antigen gp100
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C43H68N12O13Masse moléculaire :961.09 g/molEBV LMP2 200-208 (HLA-B*40:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FYFENLLAK^-OH
<p>Peptide H-FYFENLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Sun A gene (2-61), 60 amino acid polypeptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-YGGFLRRIR^PKLKWDNQ-OH
<p>Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-54/aa213 - 227
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,550.7 g/molH-IL^DTAGREEY-OH
<p>Peptide H-IL^DTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 51 (AHELVCSMENTRATK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,689.9 g/molAminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.Degré de pureté :Min. 95%H2N-Ser-Cys-Arg-Trp-Arg-Phe-Pro-Ala-Arg-Pro-Gly-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C63H96N22O15S1Masse moléculaire :1,433.64 g/molMyr-SIYRRGARRWRKL-OH
Peptide Myr-SIYRRGARRWRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESNFNTQATNR^-OH
<p>Peptide H-FESNFNTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ETFG-OH
Peptide Ac-ETFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESSAAKLKRKYWWKNLK^-OH
<p>Peptide H-FESSAAKLKRKYWWKNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2
<p>Peptide Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PLL-OH
<p>Peptide Ac-PLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AT2 Blocking Peptide
<p>A synthetic AT2 Blocking peptide for use as a blocking control in assays to test for specificity of AT2 antibody, catalog no. 70R-AR006</p>Degré de pureté :Min. 95%H-EKAHDGGR^YYRA-OH
<p>Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-DRVYIHPF-OH
<p>Peptide 5Fam-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Lys(Boc)-OH
CAS :<p>Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, strept</p>Formule :C26H32N2O6Degré de pureté :Min. 98.0 Area-%Masse moléculaire :468.54 g/molH-HQFLLTGDTQGR^-OH
<p>Peptide H-HQFLLTGDTQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEGLQEALLK^^-OH
<p>Peptide H-TEGLQEALLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Phosphatidylcholine-sterol acyltransferase [086-099]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMet-Enkephalin
<p>Peptide Met-Enkephalin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C27H35N5O7SMasse moléculaire :573.67 g/mol(Des-Glu²²)-Amyloid β-Protein (1-42)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C198H304N54O57SMasse moléculaire :4,384.99 g/molH-APPDNLPSPGGSR^-OH
<p>Peptide H-APPDNLPSPGGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-KYEQYIKW-NH2
Peptide LCBiot-KYEQYIKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 107
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,529.8 g/molAc-SNKYLDGNANKSTSDGSC-NH2
<p>Peptide Ac-SNKYLDGNANKSTSDGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSEKTFKQRRTFEQC-NH2
<p>Peptide H-PSEKTFKQRRTFEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-RRRR-OH
<p>Peptide 5Fam-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 39
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,778.1 g/molNeuromedin B (porcine)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C52H73N15O12SMasse moléculaire :1,132.3 g/molH-ALEKDY-NH2
<p>Peptide H-ALEKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 38 (IHASGKQMWQARLTV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,726 g/molH-ARPALEDLR^-OH
<p>Peptide H-ARPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Exenatide Acetate (1 to 12)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C54H83N15O21Masse moléculaire :1,278.4 g/molV5 Epitope Tag
Peptide V5 Epitope Tag is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C64H1081N16O20Masse moléculaire :1,421.67 g/molH-YL^GEEYVK^-OH
<p>Peptide H-YL^GEEYVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 22
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,852.1 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH
CAS :<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH is a basic protein that is a member of the growth factor β1 family. It has been shown to increase collagen production and inhibit the transcription of pro-apoptotic proteins in the carcinoma cell lines. H-Gly-Arg-Ala-Asp-Ser-Pro-OH is also known as RGD peptides, which are derived from collagen. It has been found to induce genotoxic effects, such as chromosomal aberrations and sister chromatid exchanges, in cells.</p>Formule :C23H39N9O10Degré de pureté :Min. 95%Masse moléculaire :601.61 g/molZnT-8 114-123 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-PRYVKQNTLKLAT-NH2
<p>Peptide Ac-PRYVKQNTLKLAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEDSLVFVQTDK^-OH
<p>Peptide H-NEDSLVFVQTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QTALVELLK^-OH
<p>Peptide H-QTALVELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEVAGSLIFR^-OH
<p>Peptide H-IQEVAGSLIFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFGFPVHYTDVSNMSR^-OH
<p>Peptide H-VFGFPVHYTDVSNMSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-GGSEGKSSGSGSESKSTGGS-NH2
<p>Peptide LCBiot-GGSEGKSSGSGSESKSTGGS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RACGAP1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-CCCCCC-NH2
<p>Peptide H-CCCCCC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nucleoprotein (396-404)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C50H71N13O14Masse moléculaire :1,078.18 g/molHemokinin 1 (mouse, rat)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C61H100N22O15SMasse moléculaire :1,413.65 g/molH-AEIEYLEK^-OH
<p>Peptide H-AEIEYLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSPGGTPTAIK^-OH
<p>Peptide H-YSPGGTPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFRRRL-NH2
<p>Peptide H-TFRRRL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CKLQHVYKRLAMGDNVL-OH
<p>Peptide Ac-CKLQHVYKRLAMGDNVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RRDVAEPAKGAQPDC-NH2
Peptide Ac-RRDVAEPAKGAQPDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGVDDAFYTLVR^^-OH
<p>Peptide H-QGVDDAFYTLVR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIF1 α 788-822
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :3,830.25 g/molH-VGRP^EWWMDYQK^-OH
Peptide H-VGRP^EWWMDYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QVPLRPMTY-OH
<p>Peptide Ac-QVPLRPMTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APLTKPLK^-OH
<p>Peptide H-APLTKPLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-EDQVDPRLIDGK-OH
<p>Peptide LCBiot-EDQVDPRLIDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGV^ITSPDFPNPYP^K^-OH
<p>Peptide H-TGV^ITSPDFPNPYP^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVSGTLIGLEFIR^-OH
<p>Peptide H-GTVSGTLIGLEFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CS-NH2
<p>Peptide Ac-CS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![Phosphatidylcholine-sterol acyltransferase [086-099]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50833.webp&w=3840&q=75)
