CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

30292 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • 5TAMRA-GEEEGECY-OH


    <p>Peptide 5TAMRA-GEEEGECY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48568

    ne
    À demander
  • Ac-KNEED-OH


    <p>Peptide Ac-KNEED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46809

    ne
    À demander
  • H-FKDPNAPK^-OH


    <p>Peptide H-FKDPNAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48709

    ne
    À demander
  • Ac-NAF-NH2


    <p>Peptide Ac-NAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45515

    ne
    À demander
  • Biot-QEQLERALNSS-OH


    <p>Peptide Biot-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45210

    ne
    À demander
  • Ac-GTFIIDPGGVIR-NH2


    <p>Peptide Ac-GTFIIDPGGVIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41824

    ne
    À demander
  • H-DLVFSTWDHK^-OH


    Peptide H-DLVFSTWDHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42215

    ne
    À demander
  • H-DSAHGFLK^-OH


    <p>Peptide H-DSAHGFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41991

    ne
    À demander
  • CMVpp65 - 57 (KVYLESFCEDVPSGK)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,700.9 g/mol

    Ref: 3D-PP50928

    ne
    À demander
  • H-VGYMHWYQQKPGK^-OH


    <p>Peptide H-VGYMHWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41075

    ne
    À demander
  • Palmitic Acid-TFRRRLSRATR-NH2


    <p>Peptide Palmitic Acid-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43583

    ne
    À demander
  • H-SVNELIYK^-OH


    <p>Peptide H-SVNELIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41045

    ne
    À demander
  • H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C28H49N7O11
    Masse moléculaire :659.74 g/mol

    Ref: 3D-PP50698

    ne
    À demander
  • H-MIQPSASGSLVGR^-OH


    <p>Peptide H-MIQPSASGSLVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42075

    ne
    À demander
  • Ac-QNTFEEFPLSDIE-OH


    Peptide Ac-QNTFEEFPLSDIE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45040

    ne
    À demander
  • Boc-ß-Ala-OH

    CAS :
    <p>Boc-ß-Ala-OH is an amino acid that inhibits the activity of gamma-aminobutyric acid (GABA) receptors. It has been shown to bind to the GABA receptor and block its activation by GABA. Boc-ß-Ala-OH is used as a building block for peptide synthesis, where it can be coupled with other amino acids to form a desired peptide sequence. This amino acid also possesses intramolecular hydrogen bonding interactions, which have been found to contribute to its inhibitory properties. Boc-ß-Ala-OH has a phase transition temperature of 104°C and is soluble in water below this point.</p>
    Formule :C8H15NO
    Degré de pureté :Min. 95%
    Masse moléculaire :189.21 g/mol

    Ref: 3D-BBA-2131

    5g
    158,00€
    25g
    197,00€
    100g
    463,00€
  • H-QIYGAK^-OH


    <p>Peptide H-QIYGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40201

    ne
    À demander
  • Neuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :937.05 g/mol

    Ref: 3D-PP50270

    ne
    À demander
  • H-ISADAMMQALLGAR^-OH


    <p>Peptide H-ISADAMMQALLGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42253

    ne
    À demander
  • HIV - 1 MN ENV - 12


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,556.8 g/mol

    Ref: 3D-PP50060

    ne
    À demander
  • H-SDAPI^GK-OH


    <p>Peptide H-SDAPI^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45426

    ne
    À demander
  • H-ISQAVHAAHAEINEAGR^-OH


    Peptide H-ISQAVHAAHAEINEAGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48022

    ne
    À demander
  • H-NNIL^R^-OH


    <p>Peptide H-NNIL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41881

    ne
    À demander
  • Fibronectin Active Fragment (RGDS)

    CAS :
    <p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>
    Formule :C15H27N7O8
    Degré de pureté :Min. 95%
    Masse moléculaire :433.42 g/mol

    Ref: 3D-PFA-4171-V

    500µg
    164,00€
  • Ac-KKVAVVRTPPKSPSSAKSR-NH2


    Peptide Ac-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49762

    ne
    À demander
  • H-EILVGDVGQTVDDPYATFVK^-OH


    <p>Peptide H-EILVGDVGQTVDDPYATFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40439

    ne
    À demander
  • Ac-CDVRNLYLESTMDEY-OH


    <p>Peptide Ac-CDVRNLYLESTMDEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43847

    ne
    À demander
  • Histone H3 (1-10)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50774

    ne
    À demander
  • Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB


    Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.
    Degré de pureté :Min. 95%

    Ref: 3D-RAM-1051-PI

    5g
    225,00€
    25g
    718,00€
  • Ac-AKFVAAWTLKA-NH2


    Peptide Ac-AKFVAAWTLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48371

    ne
    À demander
  • SIVmac239 - 40


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,775.1 g/mol

    Ref: 3D-PP50017

    ne
    À demander
  • CONSENSUS B Tat - 15


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,681.8 g/mol

    Ref: 3D-PP50449

    ne
    À demander
  • Ac-CENQIYDLPEGAHEHFPV-OH


    Peptide Ac-CENQIYDLPEGAHEHFPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45835

    ne
    À demander
  • HXB2 gag NO-117


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,611.8 g/mol

    Ref: 3D-PP50083

    ne
    À demander
  • Ac-CRSRGPSQAEREGPG-NH2


    <p>Peptide Ac-CRSRGPSQAEREGPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46244

    ne
    À demander
  • HBV env (335 - 343)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C56H84N10O11
    Masse moléculaire :1,073.35 g/mol

    Ref: 3D-PP50280

    ne
    À demander
  • Fmoc-Lys(Boc)-OH

    CAS :
    <p>Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, strept</p>
    Formule :C26H32N2O6
    Degré de pureté :Min. 98.0 Area-%
    Masse moléculaire :468.54 g/mol

    Ref: 3D-FLK-1726-PI

    5g
    135,00€
    25g
    219,00€
    100g
    580,00€
  • Val-Ile-Pro


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C16H29N3O4
    Masse moléculaire :327.42 g/mol

    Ref: 3D-PP50670

    ne
    À demander
  • H-AEDVCDLP-NH2


    <p>Peptide H-AEDVCDLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42949

    ne
    À demander
  • Melanocyte Protein PMEL 17 (256-264)

    CAS :
    <p>Peptide H-YLEPGPVTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Formule :C44H67N9O14
    Masse moléculaire :946.05 g/mol

    Ref: 3D-PP47824

    1mg
    204,00€
    10mg
    238,00€
    100mg
    427,00€
  • H-Gly-Arg-Ala-Asp-Ser-Pro-OH

    CAS :
    <p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH is a basic protein that is a member of the growth factor β1 family. It has been shown to increase collagen production and inhibit the transcription of pro-apoptotic proteins in the carcinoma cell lines. H-Gly-Arg-Ala-Asp-Ser-Pro-OH is also known as RGD peptides, which are derived from collagen. It has been found to induce genotoxic effects, such as chromosomal aberrations and sister chromatid exchanges, in cells.</p>
    Formule :C23H39N9O10
    Degré de pureté :Min. 95%
    Masse moléculaire :601.61 g/mol

    Ref: 3D-PCI-3910-PI

    5mg
    135,00€
    25mg
    349,00€
  • H-Pro-Arg-bNA·HCl

    CAS :
    <p>H-Pro-Arg-bNA·HCl is a reagent, complex compound and useful intermediate with the CAS number 201998-83-6. It is a fine chemical that is used as a useful scaffold or building block for the synthesis of other chemicals. This product can be used in research and as a versatile building block for reactions.</p>
    Formule :C21H28N6O2·HCl
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :432.95 g/mol

    Ref: 3D-FP110680

    25mg
    185,00€
    50mg
    243,00€
    100mg
    344,00€
    250mg
    559,00€
  • H-GISYGR^QL^GK^KK^HR^RR^AHQ-OH


    <p>Peptide H-GISYGR^QL^GK^KK^HR^RR^AHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42615

    ne
    À demander
  • Ac-WAKW-NH2


    <p>Peptide Ac-WAKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43290

    ne
    À demander
  • CMVpp65 - 48 (PTKDVALRHVVCAHE)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,675 g/mol

    Ref: 3D-PP50968

    ne
    À demander
  • LCBiot-EDQVDPRLIDG-OH


    Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49326

    ne
    À demander
  • Ac-Qpr-NH2


    Peptide Ac-Qpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46262

    ne
    À demander
  • H-SRPTEK-NH2


    <p>Peptide H-SRPTEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45680

    ne
    À demander
  • SIVmac239 - 123


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,828.1 g/mol

    Ref: 3D-PP50880

    ne
    À demander
  • H-TNQELQEINR^-OH


    Peptide H-TNQELQEINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41087

    ne
    À demander
  • H-AQSLVISPPAPSPR^-OH


    <p>Peptide H-AQSLVISPPAPSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49269

    ne
    À demander
  • H-YHPNGMNPYTKA-NH2


    <p>Peptide H-YHPNGMNPYTKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42927

    ne
    À demander
  • BrAc-TWPKHFDKHTFYSILKLGKH-NH2


    <p>Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Masse moléculaire :2,604.86 g/mol

    Ref: 3D-PP49901

    ne
    À demander
  • H-QLLAPGNSAGAFLIR^-OH


    Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45674

    ne
    À demander
  • Ac-CAEAETAKDN-OH


    Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46547

    ne
    À demander
  • CMVpp65 - 114 (RGRLKAESTVAPEED)


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,657.8 g/mol

    Ref: 3D-PP50979

    ne
    À demander
  • H-GEGIEEFLR^-OH


    <p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49693

    ne
    À demander
  • HLA-A*02:01 Human LMP2 LLWTLVVLL


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50742

    ne
    À demander
  • H-YLGYLEQLLR^-OH


    <p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45466

    ne
    À demander
  • Ac-KYSEEGDGPAQHAEQC-NH2


    Peptide Ac-KYSEEGDGPAQHAEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42888

    ne
    À demander
  • SIVmac239 - 60


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,715.9 g/mol

    Ref: 3D-PP50846

    ne
    À demander
  • HXB2 gag NO-103


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,776.1 g/mol

    Ref: 3D-PP50159

    ne
    À demander
  • Ac-DVSLAFSE-NH2


    <p>Peptide Ac-DVSLAFSE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47959

    ne
    À demander
  • H-GATQQILDEAER^-OH


    <p>Peptide H-GATQQILDEAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41673

    ne
    À demander
  • H-HLDDLK^^-OH


    <p>Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40095

    ne
    À demander
  • H-DPTFIPAPIQAK^-OH


    <p>Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42197

    ne
    À demander
  • H-TWNDPSVQQDIK^-OH


    <p>Peptide H-TWNDPSVQQDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49243

    ne
    À demander
  • (Pyr 3)-Amyloid β-protein (3-42)

    CAS :
    <p>Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>
    Formule :C196H299N53O55S
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :4,309.86 g/mol

    Ref: 3D-FP109366

    ne
    À demander
  • H-TPVSEK^-OH


    <p>Peptide H-TPVSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41635

    ne
    À demander
  • H-TVFHFRLL-NH2


    <p>Peptide H-TVFHFRLL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43696

    ne
    À demander
  • pE-HWSY^GL^RP^G-NH2


    <p>Peptide pE-HWSY^GL^RP^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43844

    ne
    À demander
  • H-QPGITFIAAK^-OH


    <p>Peptide H-QPGITFIAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41349

    ne
    À demander
  • H-NELESYAYSLK^-OH


    Peptide H-NELESYAYSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41873

    ne
    À demander
  • H-EGYYGYTGAFR^-OH


    Peptide H-EGYYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43080

    ne
    À demander
  • Recombinant Pseudomonas aeruginosa III protein PscF (pscF)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP49967

    ne
    À demander
  • Ac-CRLVSDVFPSARDF-NH2


    Peptide Ac-CRLVSDVFPSARDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46700

    ne
    À demander
  • Ac-CYPYDVPDYA-OH


    <p>Peptide Ac-CYPYDVPDYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48431

    ne
    À demander
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


    Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).

    Ref: 3D-PP41946

    ne
    À demander
  • H-LNIPTDVLK^-OH


    <p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42147

    ne
    À demander
  • HLA-B*15:01 Human pp65 KMQVIGDQY


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

    Ref: 3D-PP50738

    ne
    À demander
  • H-GTFTASQNYLR^-OH


    <p>Peptide H-GTFTASQNYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40815

    ne
    À demander
  • H-FVEGLPINDFSR^-OH


    Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47372

    ne
    À demander
  • H-LFLEPTQADIALL^K-OH


    <p>Peptide H-LFLEPTQADIALL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48922

    ne
    À demander
  • sgp91 ds-tat Peptide 2, scrambled


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C98H190N50O22S
    Masse moléculaire :2,453 g/mol

    Ref: 3D-PP50288

    ne
    À demander
  • H-SSDTEENVK^-OH


    <p>Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41573

    ne
    À demander
  • H-CQPLGMISLMK^-OH


    <p>Peptide H-CQPLGMISLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41253

    ne
    À demander
  • Ac-YPYDVPDYAS-NH2


    Peptide Ac-YPYDVPDYAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42975

    ne
    À demander
  • H-ARV^YIHPF-OH


    <p>Peptide H-ARV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40561

    ne
    À demander
  • Mal-RSQSRSRYYRQRQRSRRRRRRS-NH2


    <p>Peptide Mal-RSQSRSRYYRQRQRSRRRRRRS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49090

    ne
    À demander
  • H-LVLPEYGR^-OH


    <p>Peptide H-LVLPEYGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40769

    ne
    À demander
  • Ac-RGGGGLGLGK-NH2


    Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45363

    ne
    À demander
  • H-FTQAGSEVSALLGR^-OH


    <p>Peptide H-FTQAGSEVSALLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40607

    ne
    À demander
  • Premelanosome Protein (PMEL) (C-Term)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50467

    ne
    À demander
  • H-EQVTNVGGAVVTGVTAVAQK^-OH


    Peptide H-EQVTNVGGAVVTGVTAVAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41463

    ne
    À demander
  • Boc-D-Met-OH

    CAS :
    Boc-D-Met-OH is an amino acid building block that is used in the synthesis of peptides. It has been shown to have photophysical properties and specificities, as well as a helical structure. Boc-D-Met-OH has also been shown to react with anions, making it useful for peptide synthesis.
    Formule :C10H19NO4S
    Degré de pureté :Min. 95%
    Masse moléculaire :249.33 g/mol

    Ref: 3D-BDM-2608

    1g
    164,00€
    5g
    230,00€
    25g
    710,00€
  • H-RF^-OH


    Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45057

    ne
    À demander
  • H-GFYYSLK^-OH


    <p>Peptide H-GFYYSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41483

    ne
    À demander