
Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30292 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
5TAMRA-GEEEGECY-OH
<p>Peptide 5TAMRA-GEEEGECY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KNEED-OH
<p>Peptide Ac-KNEED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FKDPNAPK^-OH
<p>Peptide H-FKDPNAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NAF-NH2
<p>Peptide Ac-NAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-QEQLERALNSS-OH
<p>Peptide Biot-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GTFIIDPGGVIR-NH2
<p>Peptide Ac-GTFIIDPGGVIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLVFSTWDHK^-OH
Peptide H-DLVFSTWDHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSAHGFLK^-OH
<p>Peptide H-DSAHGFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 57 (KVYLESFCEDVPSGK)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,700.9 g/molH-VGYMHWYQQKPGK^-OH
<p>Peptide H-VGYMHWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Palmitic Acid-TFRRRLSRATR-NH2
<p>Peptide Palmitic Acid-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVNELIYK^-OH
<p>Peptide H-SVNELIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C28H49N7O11Masse moléculaire :659.74 g/molH-MIQPSASGSLVGR^-OH
<p>Peptide H-MIQPSASGSLVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QNTFEEFPLSDIE-OH
Peptide Ac-QNTFEEFPLSDIE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-ß-Ala-OH
CAS :<p>Boc-ß-Ala-OH is an amino acid that inhibits the activity of gamma-aminobutyric acid (GABA) receptors. It has been shown to bind to the GABA receptor and block its activation by GABA. Boc-ß-Ala-OH is used as a building block for peptide synthesis, where it can be coupled with other amino acids to form a desired peptide sequence. This amino acid also possesses intramolecular hydrogen bonding interactions, which have been found to contribute to its inhibitory properties. Boc-ß-Ala-OH has a phase transition temperature of 104°C and is soluble in water below this point.</p>Formule :C8H15NODegré de pureté :Min. 95%Masse moléculaire :189.21 g/molH-QIYGAK^-OH
<p>Peptide H-QIYGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :937.05 g/molH-ISADAMMQALLGAR^-OH
<p>Peptide H-ISADAMMQALLGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 12
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,556.8 g/molH-SDAPI^GK-OH
<p>Peptide H-SDAPI^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISQAVHAAHAEINEAGR^-OH
Peptide H-ISQAVHAAHAEINEAGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNIL^R^-OH
<p>Peptide H-NNIL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fibronectin Active Fragment (RGDS)
CAS :<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>Formule :C15H27N7O8Degré de pureté :Min. 95%Masse moléculaire :433.42 g/molAc-KKVAVVRTPPKSPSSAKSR-NH2
Peptide Ac-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EILVGDVGQTVDDPYATFVK^-OH
<p>Peptide H-EILVGDVGQTVDDPYATFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDVRNLYLESTMDEY-OH
<p>Peptide Ac-CDVRNLYLESTMDEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Histone H3 (1-10)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.Degré de pureté :Min. 95%Ac-AKFVAAWTLKA-NH2
Peptide Ac-AKFVAAWTLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 40
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,775.1 g/molCONSENSUS B Tat - 15
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,681.8 g/molAc-CENQIYDLPEGAHEHFPV-OH
Peptide Ac-CENQIYDLPEGAHEHFPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-117
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,611.8 g/molAc-CRSRGPSQAEREGPG-NH2
<p>Peptide Ac-CRSRGPSQAEREGPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HBV env (335 - 343)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C56H84N10O11Masse moléculaire :1,073.35 g/mol(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-hydroxypropanoyl]amino ]-4-oxobutanoyl]amino]-4-oxobutanoyl]amino]-3-phenylpropanoyl]amino]acetyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C43H68N12O16Masse moléculaire :1,009.09 g/molFmoc-Lys(Boc)-OH
CAS :<p>Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, strept</p>Formule :C26H32N2O6Degré de pureté :Min. 98.0 Area-%Masse moléculaire :468.54 g/molVal-Ile-Pro
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C16H29N3O4Masse moléculaire :327.42 g/molH-AEDVCDLP-NH2
<p>Peptide H-AEDVCDLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melanocyte Protein PMEL 17 (256-264)
CAS :<p>Peptide H-YLEPGPVTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C44H67N9O14Masse moléculaire :946.05 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH
CAS :<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH is a basic protein that is a member of the growth factor β1 family. It has been shown to increase collagen production and inhibit the transcription of pro-apoptotic proteins in the carcinoma cell lines. H-Gly-Arg-Ala-Asp-Ser-Pro-OH is also known as RGD peptides, which are derived from collagen. It has been found to induce genotoxic effects, such as chromosomal aberrations and sister chromatid exchanges, in cells.</p>Formule :C23H39N9O10Degré de pureté :Min. 95%Masse moléculaire :601.61 g/molH-Pro-Arg-bNA·HCl
CAS :<p>H-Pro-Arg-bNA·HCl is a reagent, complex compound and useful intermediate with the CAS number 201998-83-6. It is a fine chemical that is used as a useful scaffold or building block for the synthesis of other chemicals. This product can be used in research and as a versatile building block for reactions.</p>Formule :C21H28N6O2·HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :432.95 g/molH-GISYGR^QL^GK^KK^HR^RR^AHQ-OH
<p>Peptide H-GISYGR^QL^GK^KK^HR^RR^AHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-WAKW-NH2
<p>Peptide Ac-WAKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 48 (PTKDVALRHVVCAHE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,675 g/mol2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C80H138N26O24S2Masse moléculaire :1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Qpr-NH2
Peptide Ac-Qpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SRPTEK-NH2
<p>Peptide H-SRPTEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 123
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,828.1 g/molH-TNQELQEINR^-OH
Peptide H-TNQELQEINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQSLVISPPAPSPR^-OH
<p>Peptide H-AQSLVISPPAPSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YHPNGMNPYTKA-NH2
<p>Peptide H-YHPNGMNPYTKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BrAc-TWPKHFDKHTFYSILKLGKH-NH2
<p>Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Masse moléculaire :2,604.86 g/molH-QLLAPGNSAGAFLIR^-OH
Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 114 (RGRLKAESTVAPEED)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,657.8 g/molH-GEGIEEFLR^-OH
<p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HLA-A*02:01 Human LMP2 LLWTLVVLL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-YLGYLEQLLR^-OH
<p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KYSEEGDGPAQHAEQC-NH2
Peptide Ac-KYSEEGDGPAQHAEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 60
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,715.9 g/molHXB2 gag NO-103
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,776.1 g/molAc-DVSLAFSE-NH2
<p>Peptide Ac-DVSLAFSE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GATQQILDEAER^-OH
<p>Peptide H-GATQQILDEAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLDDLK^^-OH
<p>Peptide H-HLDDLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPTFIPAPIQAK^-OH
<p>Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TWNDPSVQQDIK^-OH
<p>Peptide H-TWNDPSVQQDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Pyr 3)-Amyloid β-protein (3-42)
CAS :<p>Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C196H299N53O55SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :4,309.86 g/mol(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[2-[[(2S,3R)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-1-[2-[[(2S)-2-[[( 2S)-2-[[2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C147H259N67O36SMasse moléculaire :3,573.15 g/molH-TPVSEK^-OH
<p>Peptide H-TPVSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVFHFRLL-NH2
<p>Peptide H-TVFHFRLL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pE-HWSY^GL^RP^G-NH2
<p>Peptide pE-HWSY^GL^RP^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QPGITFIAAK^-OH
<p>Peptide H-QPGITFIAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NELESYAYSLK^-OH
Peptide H-NELESYAYSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGYYGYTGAFR^-OH
Peptide H-EGYYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Recombinant Pseudomonas aeruginosa III protein PscF (pscF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-CRLVSDVFPSARDF-NH2
Peptide Ac-CRLVSDVFPSARDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CYPYDVPDYA-OH
<p>Peptide Ac-CYPYDVPDYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).H-LNIPTDVLK^-OH
<p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HLA-B*15:01 Human pp65 KMQVIGDQY
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-GTFTASQNYLR^-OH
<p>Peptide H-GTFTASQNYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVEGLPINDFSR^-OH
Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFLEPTQADIALL^K-OH
<p>Peptide H-LFLEPTQADIALL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>sgp91 ds-tat Peptide 2, scrambled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C98H190N50O22SMasse moléculaire :2,453 g/molH-SSDTEENVK^-OH
<p>Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CQPLGMISLMK^-OH
<p>Peptide H-CQPLGMISLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-YPYDVPDYAS-NH2
Peptide Ac-YPYDVPDYAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARV^YIHPF-OH
<p>Peptide H-ARV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mal-RSQSRSRYYRQRQRSRRRRRRS-NH2
<p>Peptide Mal-RSQSRSRYYRQRQRSRRRRRRS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVLPEYGR^-OH
<p>Peptide H-LVLPEYGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RGGGGLGLGK-NH2
Peptide Ac-RGGGGLGLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTQAGSEVSALLGR^-OH
<p>Peptide H-FTQAGSEVSALLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Premelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-EQVTNVGGAVVTGVTAVAQK^-OH
Peptide H-EQVTNVGGAVVTGVTAVAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-D-Met-OH
CAS :Boc-D-Met-OH is an amino acid building block that is used in the synthesis of peptides. It has been shown to have photophysical properties and specificities, as well as a helical structure. Boc-D-Met-OH has also been shown to react with anions, making it useful for peptide synthesis.Formule :C10H19NO4SDegré de pureté :Min. 95%Masse moléculaire :249.33 g/molH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYYSLK^-OH
<p>Peptide H-GFYYSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
