Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29595 produits trouvés pour "Peptides"
Fmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Aloc-DL-Orn (Boc)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H24N2O6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :497.67 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/molInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formule :C41H67N9O13Masse moléculaire :894.04 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formule :C73H117N19O19Masse moléculaire :1,564.86 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formule :C63H98N16O23S3Masse moléculaire :1,543.77 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Formule :C22H26N4O6Masse moléculaire :442.48 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formule :C68H113N19O19Masse moléculaire :1,500.77 g/molMBP (90-106)
Catalogue peptide; min. 95% purity
Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS :Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H63N15O13Degré de pureté :Min. 95%Masse moléculaire :1,082.13 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Formule :C119H204N34O32SMasse moléculaire :2,655.23 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molgp100 (570-579)
Catalogue peptide; min. 95% purity
Formule :C41H71N11O17Masse moléculaire :990.09 g/molBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formule :C62H101N17O19Masse moléculaire :1,388.58 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS :Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formule :C33H44N10O7•(HCl)xDegré de pureté :Min. 95%Masse moléculaire :692.77 g/molMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C101H172N30O32Masse moléculaire :2,318.66 g/molH-Thr-Asp-OH TFA salt
CAS :Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C8H14N2O6C2F3HO2Degré de pureté :Min. 95%Masse moléculaire :348.23 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formule :C61H94N18O16Masse moléculaire :1,335.5 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Formule :C72H115N17O18S2Masse moléculaire :1,570.95 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C180H287N57O48Masse moléculaire :4,017.55 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formule :C35H51N9O8Masse moléculaire :725.85 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Formule :C74H121N17O20SMasse moléculaire :1,600.9 g/molZ-Gly-Gly-Trp-OH TFA
CAS :Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C23H24N4O6•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :566.48 g/molGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formule :C194H318N62O62SMasse moléculaire :4,543.14 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formule :C167H258N46O48SMasse moléculaire :3,710.26 g/molEndokinin A/B
Catalogue peptide; min. 95% purity
Formule :C50H77N13O12SMasse moléculaire :1,084.32 g/molbeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Formule :C88H124N22O26Masse moléculaire :2,466 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS :Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formule :C18H33N5O4Masse moléculaire :383.49 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formule :C59H89N17O14Masse moléculaire :1,260.47 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formule :C45H59N11O8Masse moléculaire :882.04 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formule :C97H160N26O32Masse moléculaire :2,202.51 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formule :C70H101N21O18Masse moléculaire :1,524.72 g/molγ-Bag Cell Peptide
Catalogue peptide; min. 95% purity
Formule :C31H51N11O8Masse moléculaire :705.82 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formule :C35H60N12O7Masse moléculaire :760.94 g/molKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formule :C34H50N8O6SMasse moléculaire :698.9 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formule :C90H136N22O28S2Masse moléculaire :2,038.34 g/molSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formule :C59H82N14O18Masse moléculaire :1,275.4 g/molγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formule :C155H242N40O49SMasse moléculaire :3,481.96 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS :H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formule :C28H53N7O8Degré de pureté :Min. 95%Masse moléculaire :615.76 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formule :C60H105N21O12Masse moléculaire :1,312.64 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formule :C151H211N37O39SMasse moléculaire :3,199.65 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C41H43FN4O14Degré de pureté :Min. 95%Masse moléculaire :834.8 g/molHead activator
Catalogue peptide; min. 95% purity
Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formule :C69H122N26O22Masse moléculaire :1,667.90 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formule :C33H45N6O12PMasse moléculaire :748.8 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS :Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C53H80N20O18Degré de pureté :Min. 95%Masse moléculaire :1,285.3 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS :Catalogue peptide; min. 95% purity
Formule :C121H193N33O30SMasse moléculaire :2,638.15 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formule :C64H100N18O14Masse moléculaire :1,345.62 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formule :C44H62N10O10S2Masse moléculaire :955.17 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS :Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formule :C32H50N4O8Degré de pureté :Min. 95%Masse moléculaire :618.76 g/molZ-Ile-Val-OH
CAS :Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formule :C59H97N17O19Masse moléculaire :1,348.53 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Formule :C60H87N17O13SMasse moléculaire :1,286.53 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formule :C145H238N48O38S2Masse moléculaire :3,325.86 g/molFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formule :C16H29N3O6Masse moléculaire :359.43 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formule :C15H28N4O5Masse moléculaire :344.41 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formule :C64H114N22O12Masse moléculaire :1,383.76 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C66H109N23O23Masse moléculaire :1,592.74 g/molInfluenza A NP (366-374)
Catalogue peptide; min. 95% purity
Formule :C36H59N11O17S2Masse moléculaire :982.06 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formule :C107H141N22O37PS2Masse moléculaire :2,422.53 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formule :C59H104N22O20Masse moléculaire :1,441.62 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formule :C112H197N39O30Masse moléculaire :2,570 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS :Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C149H246N44O42SDegré de pureté :Min. 95%Masse moléculaire :3,357.88 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formule :C107H140N22O34S2Masse moléculaire :2,342.56 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formule :C194H296N54O57SMasse moléculaire :4,328.91 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/mol[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formule :C189H285N55O57SMasse moléculaire :4,271.67 g/molBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formule :C67H87N15O14Masse moléculaire :1,326.53 g/molIntermedin (rat)
Catalogue peptide; min. 95% purity
Formule :C226H361N75O64S2Masse moléculaire :5,216.99 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formule :C264H426N74O97SMasse moléculaire :6,220.84 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formule :C42H61N11O10Masse moléculaire :880.02 g/molGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formule :C54H89N13O13SMasse moléculaire :1,159.45 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formule :C77H109N21O19SMasse moléculaire :1,664.92 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
