Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29654 produits trouvés pour "Peptides"
Amyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formule :C45H82N14O13SMasse moléculaire :1,059.31 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formule :C72H103N19O16SMasse moléculaire :1,522.81 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formule :C28H45N7O9Masse moléculaire :623.71 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formule :C89H152N22O15Masse moléculaire :1,770.34 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formule :C50H65N11O11S2Masse moléculaire :1,060.29 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formule :C33H45N6O12PMasse moléculaire :748.8 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/molbeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Formule :C42H66N10O15Masse moléculaire :951.05 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formule :C137H212N42O39SMasse moléculaire :3,103.54 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formule :C59H89N17O14Masse moléculaire :1,260.47 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formule :C28H36N6O6Masse moléculaire :552.64 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formule :C79H120N18O21Masse moléculaire :1,657.95 g/molEndokinin A/B
Catalogue peptide; min. 95% purity
Formule :C50H77N13O12SMasse moléculaire :1,084.32 g/molDesmopressin
CAS :Produit contrôléDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formule :C46H64N14O12S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,069.22 g/molZ-Gly-Gly-Trp-OH TFA
CAS :Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C23H24N4O6•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :566.48 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formule :C68H113N19O19Masse moléculaire :1,500.77 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Formule :C72H115N17O18S2Masse moléculaire :1,570.95 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Prepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formule :C118H182N32O32Masse moléculaire :2,560.96 g/molH-Asp-beta-Ala-OH
CAS :Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H12N2O5Degré de pureté :Min. 90 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formule :C35H51N9O8Masse moléculaire :725.85 g/molH-D-Phe-pip-Arg-pna acetate
CAS :H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formule :C27H36N8O5Degré de pureté :Min. 95%Masse moléculaire :552.6 g/molRef: 3D-QEA38896
Produit arrêtéAF-16 trifluoroacetate salt
CAS :AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formule :C71H119N25O25SDegré de pureté :Min. 95%Masse moléculaire :1,754.92 g/molRef: 3D-FA109941
Produit arrêtéCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Peptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formule :C190H288N54O57Masse moléculaire :4,240.64 g/molZ-Ile-Val-OH
CAS :Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/molH-His-Arg-OH
CAS :H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Formule :C157H261N49O43S6Masse moléculaire :3,715.47 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS :Produit contrôléPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C14H24N2O6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :497.67 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molBoc-D-His(Boc)-OH benzene solvate
CAS :Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C16H25N3O6Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :355.39 g/molBCIP dipotassium
CAS :BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formule :C8H4BrClK2NO4PDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :402.65 g/molBoc-D-Glu-OEt·DCHA
CAS :Produit contrôléPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H21NO6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :456.62 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formule :C69H122N26O22Masse moléculaire :1,667.90 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formule :C107H140N22O34S2Masse moléculaire :2,342.56 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formule :C97H160N26O32Masse moléculaire :2,202.51 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS :Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formule :C107H141N22O37PS2Masse moléculaire :2,422.53 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formule :C64H114N22O12Masse moléculaire :1,383.76 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C185H268N48O51S2Masse moléculaire :4,044.63 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formule :C77H109N21O19SMasse moléculaire :1,664.92 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C180H287N57O48Masse moléculaire :4,017.55 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
