Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29695 produits trouvés pour "Peptides"
TNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formule :C69H122N26O22Masse moléculaire :1,667.90 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formule :C90H136N22O28S2Masse moléculaire :2,038.34 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formule :C47H72N14O11Masse moléculaire :1,009.19 g/molZ-Asp-Gln-Met-Asp-AFC
CAS :Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C36H39F3N6O13SDegré de pureté :Min. 95%Masse moléculaire :852.79 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formule :C107H140N22O34S2Masse moléculaire :2,342.56 g/mol[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formule :C78H121N21O20Masse moléculaire :1,673 g/molbeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Formule :C68H113N19O19Masse moléculaire :1,500.77 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formule :C15H28N4O5Masse moléculaire :344.41 g/molH-D-Phe-pip-Arg-pna acetate
CAS :H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formule :C27H36N8O5Degré de pureté :Min. 95%Masse moléculaire :552.6 g/molRef: 3D-QEA38896
Produit arrêtépp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C66H109N23O23Masse moléculaire :1,592.74 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formule :C77H109N21O19SMasse moléculaire :1,664.92 g/molGLP-2 (rat)
Catalogue peptide; min. 95% purity
Formule :C166H256N44O56SMasse moléculaire :3,796.22 g/molBTK derived peptide
Catalogue peptide; min. 95% purity
Formule :C72H115N17O18S2Masse moléculaire :1,570.95 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Formule :C58H77N13O10Masse moléculaire :1,116.34 g/molAntioxidant peptide A
Catalogue peptide; min. 95% purity
Formule :C31H54N12O7S2Masse moléculaire :770.97 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formule :C53H84N12O16Masse moléculaire :1,145.33 g/molCalcitonin (8-32) (salmon I)
Catalogue peptide; min. 95% purity
Formule :C119H198N36O37Masse moléculaire :2,725.06 g/molRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Formule :C80H124N24O25SMasse moléculaire :1,854.08 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formule :C35H56N8O9SMasse moléculaire :765 g/mol[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Formule :C40H65N13O7Masse moléculaire :840.05 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS :Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formule :C33H44N10O7•(HCl)xDegré de pureté :Min. 95%Masse moléculaire :692.77 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formule :C49H81N21O17Masse moléculaire :1,236.32 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C43H47FN4O15Degré de pureté :Min. 95%Masse moléculaire :878.85 g/molCorticostatin, human
Catalogue peptide; min. 95% purity
Formule :C157H261N49O43S6Masse moléculaire :3,715.47 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
TNF-α(71-82), human
Catalogue peptide; min. 95% purity
Formule :C51H91N19O18Masse moléculaire :1,258.41 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formule :C124H205N39O39S2Masse moléculaire :2,930.38 g/molTyr-Leptin (26-39) (human)
CAS :Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formule :C46H59N7O12Masse moléculaire :902.02 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS :Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C20H32N4O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :392.49 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formule :C67H110N20O17Masse moléculaire :1,467.75 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formule :C93H136N22O27Masse moléculaire :1,994.25 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formule :C116H190N32O35SMasse moléculaire :2,625 g/molSaposin C12
Catalogue peptide; min. 95% purity
Formule :C62H108N16O22Masse moléculaire :1,429.65 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formule :C171H271N51O54S2Masse moléculaire :3,969.50 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formule :C46H75N9O11S2Masse moléculaire :994.28 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formule :C59H89N17O14Masse moléculaire :1,260.47 g/mol[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Formule :C78H109N23O15SMasse moléculaire :1,640.95 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
Catalogue peptide; min. 95% purity
Formule :C46H71N15O11SMasse moléculaire :1,042.24 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formule :C46H68N10O14SMasse moléculaire :1,017.17 g/molMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Formule :C101H172N30O32Masse moléculaire :2,318.66 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formule :C76H113N25O18Masse moléculaire :1,664.90 g/molγ-TAC4 (32-50)
Catalogue peptide; min. 95% purity
Formule :C92H146N24O31Masse moléculaire :2,084.33 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formule :C42H66N12O12Masse moléculaire :931.06 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H243N41O31Masse moléculaire :3,080.83 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formule :C61H108N25O22PMasse moléculaire :1,574.69 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formule :C72H122N21O29SMasse moléculaire :1,777.92 g/molC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Formule :C50H86N22O17Masse moléculaire :1,267.38 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formule :C59H86N16O15Masse moléculaire :1,259.44 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Angiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formule :C79H116N22O17Masse moléculaire :1,645.9 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formule :C112H167N27O34S5Masse moléculaire :2,596 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/molBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formule :C126H190N34O35Masse moléculaire :2,773.19 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formule :C88H139N25O26Masse moléculaire :1,963.24 g/molHelodormin
Catalogue peptide; min. 95% purity
Formule :C176H285N47O49Masse moléculaire :3,843.47 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formule :C180H287N57O48Masse moléculaire :4,017.55 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formule :C45H82N14O13SMasse moléculaire :1,059.31 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formule :C72H103N19O16SMasse moléculaire :1,522.81 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formule :C89H152N22O15Masse moléculaire :1,770.34 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formule :C173H273N49O52S2Masse moléculaire :3,935.55 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formule :C59H97N17O19Masse moléculaire :1,348.53 g/molH-Asp-beta-Ala-OH
CAS :Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H12N2O5Degré de pureté :Min. 90 Area-%Couleur et forme :PowderMasse moléculaire :204.18 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Fas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formule :C16H29N3O6Masse moléculaire :359.43 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formule :C64H99N19O17Masse moléculaire :1,406.62 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formule :C61H94N18O16Masse moléculaire :1,335.5 g/molAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Formule :C86H119N23O23Masse moléculaire :1,843.05 g/molH-Ala-Abu-OH
CAS :Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C7H14N2O3Degré de pureté :Min. 90%Couleur et forme :PowderMasse moléculaire :174.2 g/molH-Asp-NH2
CAS :H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formule :C4H8N2O3Degré de pureté :Min. 95%Masse moléculaire :132.12 g/molRef: 3D-FA107876
Produit arrêtéBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formule :C82H122N22O25SMasse moléculaire :1,848.08 g/molBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Formule :C94H159N31O20S2Masse moléculaire :2,139.48 g/molrec IFN-gamma (human)
CAS :Produit contrôléPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Proinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Formule :C153H259N49O52Masse moléculaire :3,616.98 g/molGAP 26 trifluoroacetate salt
CAS :13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formule :C70H107N19O19SDegré de pureté :Min. 95%Masse moléculaire :1,550.78 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formule :C39H68N16O11Masse moléculaire :937.08 g/molGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formule :C97H148N26O29S2Masse moléculaire :2,206.53 g/molSaposin C18
Catalogue peptide; min. 95% purity
Formule :C93H164N24O31Masse moléculaire :2,114.49 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formule :C63H103N25O19Masse moléculaire :1,514.68 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS :Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formule :C54H103NO7SDegré de pureté :Min. 95%Masse moléculaire :910.46 g/molabIII probe
Catalogue peptide; min. 95% purity
Formule :C87H115N23O24SMasse moléculaire :1,899.09 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Met5,Arg6,7,Val8,Gly9] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00877.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
