Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29795 produits trouvés pour "Peptides"
TNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formule :C48H86N18O16Masse moléculaire :1,171.33 g/molBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formule :C149H224N44O45SMasse moléculaire :3,383.78 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formule :C35H51N9O8Masse moléculaire :725.85 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS :Catalogue peptide; min. 95% purity
Formule :C121H193N33O30SMasse moléculaire :2,638.15 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formule :C114H174N30O42SMasse moléculaire :2,668.90 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Formule :C171H254N4O16Masse moléculaire :3,870.52 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formule :C69H122N26O22Masse moléculaire :1,667.90 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS :Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/mol[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formule :C67H118N26O17Masse moléculaire :1,559.85 g/molIntermedin (human)
Catalogue peptide; min. 95% purity
Formule :C219H351N69O66S3Masse moléculaire :5,102.84 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formule :C66H102N20O13Masse moléculaire :1,383.68 g/molGAP 26 trifluoroacetate salt
CAS :13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formule :C70H107N19O19SDegré de pureté :Min. 95%Masse moléculaire :1,550.78 g/molH-His-Arg-OH
CAS :H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formule :C126H190N34O35Masse moléculaire :2,773.19 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formule :C44H62N10O10S2Masse moléculaire :955.17 g/molα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formule :C44H67N13O9Masse moléculaire :922.11 g/molAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS :Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C50H63N15O13Degré de pureté :Min. 95%Masse moléculaire :1,082.13 g/molDisulfide biotin azide
CAS :Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formule :C27H48N8O7S3Degré de pureté :Min 95%Masse moléculaire :692.92 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formule :C116H190N32O35SMasse moléculaire :2,625 g/molFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formule :C41H59N11O9Masse moléculaire :850.00 g/molZ-Ile-Val-OH
CAS :Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C19H28N2O5Degré de pureté :Min. 95%Masse moléculaire :364.44 g/molCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Formule :C47H85N14O13SMasse moléculaire :1,087.35 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formule :C90H136N22O28S2Masse moléculaire :2,038.34 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formule :C64H99N19O17Masse moléculaire :1,406.62 g/molTyr-Leptin (26-39) (human)
CAS :Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C80H137N19O25Degré de pureté :Min. 95%Masse moléculaire :1,765.06 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formule :C167H258N46O48SMasse moléculaire :3,710.26 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formule :C164H278N58O45S4Masse moléculaire :3,910.64 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formule :C54H79N13O17Masse moléculaire :1,182.31 g/molBiotin-Gastrin Releasing Peptide, human
Catalogue peptide; min. 95% purity
Formule :C140H218N40O33S3Masse moléculaire :3,085.74 g/molgp100 (178-187)
Catalogue peptide; min. 95% purity
Formule :C42H71N11O14S2Masse moléculaire :1,018.23 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formule :C35H56N8O9SMasse moléculaire :765 g/molEndokinin A/B
Catalogue peptide; min. 95% purity
Formule :C50H77N13O12SMasse moléculaire :1,084.32 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Formule :C119H204N34O32SMasse moléculaire :2,655.23 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formule :C33H47N9O8SMasse moléculaire :729.86 g/molAF-16 trifluoroacetate salt
CAS :AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formule :C71H119N25O25SDegré de pureté :Min. 95%Masse moléculaire :1,754.92 g/molRef: 3D-FA109941
Produit arrêté[Arg3] Substance P
Catalogue peptide; min. 95% purity
Formule :C63H98N20O13SMasse moléculaire :1,375.67 g/molPRRS-RSAB-C
Catalogue peptide; min. 95% purity
Formule :C77H102N20O23Masse moléculaire :1,675.79 g/molCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formule :C45H59N11O11Masse moléculaire :930.04 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formule :C73H117N19O19Masse moléculaire :1,564.86 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formule :C104H152N26O26Masse moléculaire :2,182.53 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formule :C53H84N12O16Masse moléculaire :1,145.33 g/molBoc-Lys(Tfa)-AMC
CAS :Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formule :C23H28F3N3O6Degré de pureté :Min. 95%Masse moléculaire :499.48 g/molα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formule :C52H74N20O15S4Masse moléculaire :1,347.58 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formule :C216H371N75O59S6Masse moléculaire :5,155.22 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formule :C79H125N23O28SMasse moléculaire :1,877.08 g/molbeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Formule :C56H76N16O22Masse moléculaire :1,325.32 g/molHylambatin
Catalogue peptide; min. 95% purity
Formule :C63H90N16O19S2Masse moléculaire :1,439.64 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formule :C104H159N29O31Masse moléculaire :2,311.60 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formule :C197H317N59O54S3Masse moléculaire :4,472.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Human CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Formule :C52H96N20O16Masse moléculaire :1,257.47 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formule :C170H253N47O52Masse moléculaire :3,787.20 g/molbeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formule :C81H128N32O19S2Masse moléculaire :1,918.25 g/molBoc-D-Glu-OEt·DCHA
CAS :Produit contrôléPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H21NO6·C12H23NDegré de pureté :Min. 95%Masse moléculaire :456.62 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formule :C74H128N16O18Masse moléculaire :1,529.95 g/molBrevinin-1
Catalogue peptide; min. 95% purity
Formule :C121H202N28O26S2Masse moléculaire :2,529.26 g/molBCIP dipotassium
CAS :BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formule :C8H4BrClK2NO4PDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :402.65 g/molBoc-D-His(Boc)-OH benzene solvate
CAS :Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C16H25N3O6Degré de pureté :Min. 95%Couleur et forme :SolidMasse moléculaire :355.39 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS :Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C33H36N2O9Degré de pureté :Min. 95%Masse moléculaire :604.65 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formule :C163H239N45O51S2Masse moléculaire :3,709.03 g/mol[Cys3, 6, Tyr8, Pro10]-Substance P
Catalogue peptide; min. 95% purity
Masse moléculaire :1,295.6 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Z-Gly-Gly-Trp-OH TFA
CAS :Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C23H24N4O6•C2HF3O2Degré de pureté :Min. 95%Masse moléculaire :566.48 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formule :C23H28N4O4Masse moléculaire :424.50 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formule :C110H178N26O31SMasse moléculaire :2,392.86 g/molCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formule :C114H175N25O42S2Masse moléculaire :2,631.93 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formule :C62H97N21O16S1Masse moléculaire :1,424.66 g/mol[Tyr1]-pTH (1-34) (rat)
Catalogue peptide; min. 95% purity
Formule :C186H295N55O49S2Masse moléculaire :4,149.86 g/mol[Asn76] PTH (64-84), human
Catalogue peptide; min. 95% purity
Formule :C94H163N27O35Masse moléculaire :2,231.51 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Formule :C131H211N43O38Masse moléculaire :2,996.41 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Formule :C74H121N17O20SMasse moléculaire :1,600.9 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formule :C40H51N5O18P2Masse moléculaire :951.86 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS :Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formule :C54H103NO7SDegré de pureté :Min. 95%Masse moléculaire :910.46 g/molMBP (90-106)
Catalogue peptide; min. 95% purity
Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molSialokinin - 2
Catalogue peptide; min. 95% purity
Formule :C51H76N12O16SMasse moléculaire :1,145.31 g/molMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Formule :C147H246N41O40P3Masse moléculaire :3,320.78 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Formule :C25H37N5O7Masse moléculaire :519.6 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formule :C184H282N56O53S2Masse moléculaire :4,190.77 g/molPrepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formule :C118H182N32O32Masse moléculaire :2,560.96 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS :Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C43H47FN4O15Degré de pureté :Min. 95%Masse moléculaire :878.85 g/mol[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formule :C78H121N21O20Masse moléculaire :1,673 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formule :C130H221N37O35SMasse moléculaire :2,894.43 g/molH-GILGFVFTL-OH
CAS :FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formule :C49H75N9O11Masse moléculaire :966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS :Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formule :C40H62N12O9•(C2HF3O2)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C48H76N12O13SMasse moléculaire :1,079.27 g/molCerebellin trifluoroacetate
CAS :Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C69H113N23O23•(C2HF3O2)4Degré de pureté :Min. 95%Masse moléculaire :2,088.86 g/molCoibamide A
CAS :Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C65H110N10O16Degré de pureté :Min. 95%Masse moléculaire :1,287.65 g/mol
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
