CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

29863 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • Ac-AAA-NH2


    Peptide Ac-AAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49530

    ne
    À demander
  • Biotinoylsarcosine

    CAS :
    Biotinoylsarcosine is a synthetic compound that is used in biotechnology as a building block for the production of biotin-conjugated proteins and peptides. Biotinoylsarcosine has been shown to bind to human serum albumin with high affinity, which may be due to its carboxylate functionalities. This chemical can also be conjugated with other molecules through multistep reactions, simplifying the process of creating biotin-conjugated compounds. Biotinoylsarcosine is deactivated by biotinidase enzymes and used as a pretargeting agent in positron emission tomography imaging studies. Streptavidin, an avidin protein, can bind this compound with high affinity and has been used in biochemical studies as a tool for peptide synthesis.
    Formule :C13H21N3O4S
    Degré de pureté :Min. 95%
    Masse moléculaire :315.39 g/mol

    Ref: 3D-DPG-5893

    1g
    483,00€
  • H-LKLKSIVSWAKKVL-NH2


    Peptide H-LKLKSIVSWAKKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48109

    ne
    À demander
  • H-GGPLDGTYR^-OH


    Peptide H-GGPLDGTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48238

    ne
    À demander
  • SIVmac239 - 93


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,522.8 g/mol

    Ref: 3D-PP50439

    ne
    À demander
  • H-KFRKAFKRFF-NTPEGBiot


    Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49469

    ne
    À demander
  • H-FQSVFTVTR^-OH


    Peptide H-FQSVFTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43057

    ne
    À demander
  • H-MVTGVASALSSR^-OH


    Peptide H-MVTGVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48210

    ne
    À demander
  • H-FVEEIIEETK^-OH


    Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41171

    ne
    À demander
  • H-LGHPDTLNQGEFK^-OH


    Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47487

    ne
    À demander
  • H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB


    H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is used as building blocks in the synthesis of peptide derivatives, such as amines, alcohols, thiols, and other amino acids. This resin has been shown to be stable in aqueous or organic solvents.

    Degré de pureté :Min. 95%

    Ref: 3D-RHW-11070-PI

    1g
    255,00€
    5g
    799,00€
  • H-ADLSGITGAR^-OH


    Peptide H-ADLSGITGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49214

    ne
    À demander
  • SH2 Domain Ligand (2)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C66H97N12O24P
    Masse moléculaire :1,473.57 g/mol

    Ref: 3D-PP49972

    ne
    À demander
  • SRC Kinase Substrate


    Peptide SRC Kinase Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Formule :C64H107N22O24P
    Masse moléculaire :1,599.69 g/mol

    Ref: 3D-PP46881

    ne
    À demander
  • Ac-PWRPSHPVWMPT-NH2


    Peptide Ac-PWRPSHPVWMPT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Masse moléculaire :1,531.8 g/mol

    Ref: 3D-PP49903

    ne
    À demander
  • Ac-CVYVRSAIQLGNYK-OH


    Peptide Ac-CVYVRSAIQLGNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46152

    ne
    À demander
  • H-VGVNGFGR^-OH


    Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49170

    ne
    À demander
  • Boc-YGGFL-OH


    Peptide Boc-YGGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44451

    ne
    À demander
  • Cyc-Biot-YCWSQYLCY-NH2


    Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45825

    ne
    À demander
  • Lys-Asp-Cys


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C13H24N4O6S1
    Masse moléculaire :364.42 g/mol

    Ref: 3D-PP50651

    ne
    À demander
  • H2N-Thr-Pro-Pro-Ala-Pro-Lys-pThr-Pro-Pro-Ser-Ser-G


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C71H115N18O26P1
    Masse moléculaire :1,672.23 g/mol

    Ref: 3D-PP50507

    ne
    À demander
  • H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2


    Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46273

    ne
    À demander
  • H-VGTQFIR^-OH


    Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48086

    ne
    À demander
  • [Glu4]-Oxytocin

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C43H65N11O13S2
    Masse moléculaire :1,008.17 g/mol

    Ref: 3D-PP50809

    ne
    À demander
  • CMVpp65 - 34 (SAAERKHRHLPVADA)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,657.9 g/mol

    Ref: 3D-PP50990

    ne
    À demander
  • H-HSDPVWQVK^-OH


    Peptide H-HSDPVWQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41693

    ne
    À demander
  • H-VLQWAKKGYYTMKSN-NTBiot


    Peptide H-VLQWAKKGYYTMKSN-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47045

    ne
    À demander
  • H-LNILNNK^-OH


    Peptide H-LNILNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45944

    ne
    À demander
  • H-FLASVSTVLTSK^-OH


    Peptide H-FLASVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40739

    ne
    À demander
  • H-RGDNNL^TRIVGGQE-OH


    Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42433

    ne
    À demander
  • H-YLFSVHWPPLKA-NTBiot


    Peptide H-YLFSVHWPPLKA-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44957

    ne
    À demander
  • H-ARTKQTARKSTGGKAPRKQLY-NH2


    Peptide H-ARTKQTARKSTGGKAPRKQLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46175

    ne
    À demander
  • H-AYPDANLLNDR^-OH


    Peptide H-AYPDANLLNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41033

    ne
    À demander
  • H-GYLPEPVTVTWNSGTLTNGVR^-OH


    Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41789

    ne
    À demander
  • H-DLYANTVL^SGGTTMYPGIADR-OH


    Peptide H-DLYANTVL^SGGTTMYPGIADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40615

    ne
    À demander
  • H-MHRQETVDCLKKFN-NH2


    Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44026

    ne
    À demander
  • H-VAGFNLLMTLR^-OH


    Peptide H-VAGFNLLMTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42291

    ne
    À demander
  • H-GLEWV^AEI^R-OH


    Peptide H-GLEWV^AEI^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47906

    ne
    À demander
  • H-ALAAELNQLR^-OH


    Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45972

    ne
    À demander
  • Arg-Glu-Gly-Val-Glu-Leu-Cys-Pro-Gly-Asn-Lys-Tyr-Gl


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C132H212N44O41S2
    Masse moléculaire :3,135.5 g/mol

    Ref: 3D-PP50547

    ne
    À demander
  • H-LTVLGQPK^-OH


    Peptide H-LTVLGQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44601

    ne
    À demander
  • Antihypertensive peptide ITTNP


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C23H40N6O9
    Masse moléculaire :544.6 g/mol

    Ref: 3D-PP50682

    ne
    À demander
  • H-RLLFRKIRRLKR-NH2


    Peptide H-RLLFRKIRRLKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42999

    ne
    À demander
  • Ac-KFVAAWTL-NH2


    Peptide Ac-KFVAAWTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48373

    ne
    À demander
  • H-NAINNGVR^-OH


    Peptide H-NAINNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41593

    ne
    À demander
  • H-SQIFSTASDNQPTVTIK^-OH


    Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46250

    ne
    À demander
  • H-VIGQGQQPSTAAR^-OH


    Peptide H-VIGQGQQPSTAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42545

    ne
    À demander
  • H-ASQSIGTNIHWYQQR^-OH


    Secondary SIL peptide for Cetuximab detection and quantification

    Ref: 3D-PP41317

    ne
    À demander
  • H-FVNEEAL^R-OH


    Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48800

    ne
    À demander
  • H-VVSVLTVLHQDWL^NGK^-OH


    Peptide H-VVSVLTVLHQDWL^NGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49827

    ne
    À demander
  • H-SLFRAVITK^-OH


    Peptide H-SLFRAVITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42137

    ne
    À demander
  • H-DGAGDVAFV^K-OH


    Peptide H-DGAGDVAFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44343

    ne
    À demander
  • H-ETEVIDPQDLLEGR^-OH


    Peptide H-ETEVIDPQDLLEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40511

    ne
    À demander
  • H-GSISIQTEEK^-OH


    Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49280

    ne
    À demander
  • H-RF^F-OH


    Peptide H-RF^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44696

    ne
    À demander
  • H-LLVVYPWTQR^-OH


    Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48978

    ne
    À demander
  • α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C51H85N11O12S
    Masse moléculaire :1,076.35 g/mol

    Ref: 3D-PP50166

    ne
    À demander
  • Ac-QEQLERALNSS-OH


    Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42972

    ne
    À demander
  • H-AHYDLR^-OH


    Peptide H-AHYDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42293

    ne
    À demander
  • Indole-D-OH


    Peptide Indole-D-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40336

    ne
    À demander
  • Ac-CMPEEGFKGTGLLGH-OH


    Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44710

    ne
    À demander
  • H-AKPALEDL^R-OH


    Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40179

    ne
    À demander
  • H-LNMLNNNYK^-OH


    Peptide H-LNMLNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42892

    ne
    À demander
  • H-IGFPWSEIR^-OH


    Peptide H-IGFPWSEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40959

    ne
    À demander
  • [Asp371]-Tyrosinase (369-377), human

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C42H66N10O16S2
    Masse moléculaire :1,031.2 g/mol

    Ref: 3D-PP50380

    ne
    À demander
  • H-ENPVVHFFKNIVTPR-NH2


    Peptide H-ENPVVHFFKNIVTPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43210

    ne
    À demander
  • H-FVTVTAEALR^-OH


    Peptide H-FVTVTAEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43277

    ne
    À demander
  • H-I^PGMVVDR-OH


    Peptide H-I^PGMVVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47155

    ne
    À demander
  • Melanotan I

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C78H111N21O19
    Masse moléculaire :1,646.9 g/mol

    Ref: 3D-PP50536

    ne
    À demander
  • H-TNLESILSYPK^-OH


    Peptide H-TNLESILSYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40745

    ne
    À demander
  • OVA peptide (257-264) TFA salt

    CAS :

    Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (257-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb. Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.
    Sold as the TFA salt

    Formule :C45H74N10O13·xC2HF3O2
    Couleur et forme :Powder
    Masse moléculaire :963.13 g/mol

    Ref: 3D-PP47154

    25mg
    345,00€
    50mg
    455,00€
    100mg
    673,00€
    250mg
    1.112,00€
    500mg
    1.643,00€
  • Ac-CAQK-NH2


    Peptide Ac-CAQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41660

    ne
    À demander
  • HBcAg (HBV) (18 - 27)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C580H78N10O15
    Masse moléculaire :1,155.3 g/mol

    Ref: 3D-PP50311

    ne
    À demander
  • H-AGAVAEEVLAAIR^-OH


    Peptide H-AGAVAEEVLAAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47779

    ne
    À demander
  • H-LTWASHEK^-OH


    Peptide H-LTWASHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43182

    ne
    À demander
  • H-V^IFDANAPV^AV^R^-OH


    Peptide H-V^IFDANAPV^AV^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43577

    ne
    À demander
  • H-YML^DLQPETT-OH


    Peptide H-YML^DLQPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47744

    ne
    À demander
  • H-TITLEVEPSDTIENV^K-OH


    Peptide H-TITLEVEPSDTIENV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41869

    ne
    À demander
  • CMVpp65 - 14 (PSLILVSQYTPDSTP)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,617.8 g/mol

    Ref: 3D-PP50966

    ne
    À demander
  • H-DLAFPGSGEQVEK^-OH


    Peptide H-DLAFPGSGEQVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47785

    ne
    À demander
  • Suc-Ala-Ala-Pro-Abu-pNA


    Suc-Ala-Ala-Pro-Abu-pNA is a peptide that has been shown to inhibit the activity of elastase, an enzyme that breaks down proteins in tissues. It is used as a substrate for enzyme assays and as a tool for studying elastase. This peptide can be used to study the structure and function of elastases, which are necessary for the breakdown of proteins in tissues.

    Formule :C25H34N6O9
    Degré de pureté :Min. 95%
    Masse moléculaire :562.58 g/mol

    Ref: 3D-SAP-3667-PI

    5mg
    136,00€
    25mg
    403,00€
  • MYH9 741-749 (HLA-A*02:01)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50196

    ne
    À demander
  • H-LGPGQSKVIG-NH2


    Peptide H-LGPGQSKVIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43452

    ne
    À demander
  • H-VIQELGLDK^-OH


    Peptide H-VIQELGLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42744

    ne
    À demander
  • H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2


    Peptide H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47669

    ne
    À demander
  • H-TVAAPSVFIFPPSDEQLK^-OH


    Peptide H-TVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43148

    ne
    À demander
  • H-E-boro-Pro-OH


    Peptide H-E-boro-Pro-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45317

    ne
    À demander
  • [Glu1] Fibrinopeptide B, human

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C66H95N19O26
    Masse moléculaire :1,570.6 g/mol

    Ref: 3D-PP50447

    ne
    À demander
  • H-GAIIGLMV^GG-OH


    Peptide H-GAIIGLMV^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40161

    ne
    À demander
  • MHC I-Strep HLA-A*0201 Prame


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50762

    ne
    À demander
  • Ac-ALQHLMDKWMAM-NH2


    Peptide Ac-ALQHLMDKWMAM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47773

    ne
    À demander
  • H-TTAVTRPVETHELIR^-OH


    Peptide H-TTAVTRPVETHELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41833

    ne
    À demander
  • CMVpp65 - 63 (DVEEDLTMTRNPQPF)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,792 g/mol

    Ref: 3D-PP50875

    ne
    À demander
  • H-SVINDPIYK^-OH


    Peptide H-SVINDPIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42547

    ne
    À demander
  • H-LGLLLHDSIQIPR^-OH


    Peptide H-LGLLLHDSIQIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48382

    ne
    À demander
  • Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2


    Peptide Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44607

    ne
    À demander
  • Gly-Ile-Pro-Val-His-Leu-Glu-Leu-Ala-Ser-Met-Thr-As


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C137H221N35O41S3
    Masse moléculaire :3,110.63 g/mol

    Ref: 3D-PP50037

    ne
    À demander
  • TAMRA-QKRPSQRSKYL-OH


    Peptide TAMRA-QKRPSQRSKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44949

    ne
    À demander
  • H-TYLPAV^DEK-OH


    Peptide H-TYLPAV^DEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43735

    ne
    À demander
  • M617

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C112H161N29O28
    Masse moléculaire :2,361.68 g/mol

    Ref: 3D-PP50368

    ne
    À demander