
Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29863 produits trouvés pour "Peptides"
Ac-AAA-NH2
Peptide Ac-AAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotinoylsarcosine
CAS :Biotinoylsarcosine is a synthetic compound that is used in biotechnology as a building block for the production of biotin-conjugated proteins and peptides. Biotinoylsarcosine has been shown to bind to human serum albumin with high affinity, which may be due to its carboxylate functionalities. This chemical can also be conjugated with other molecules through multistep reactions, simplifying the process of creating biotin-conjugated compounds. Biotinoylsarcosine is deactivated by biotinidase enzymes and used as a pretargeting agent in positron emission tomography imaging studies. Streptavidin, an avidin protein, can bind this compound with high affinity and has been used in biochemical studies as a tool for peptide synthesis.Formule :C13H21N3O4SDegré de pureté :Min. 95%Masse moléculaire :315.39 g/molH-LKLKSIVSWAKKVL-NH2
Peptide H-LKLKSIVSWAKKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGPLDGTYR^-OH
Peptide H-GGPLDGTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 93
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,522.8 g/molH-KFRKAFKRFF-NTPEGBiot
Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQSVFTVTR^-OH
Peptide H-FQSVFTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MVTGVASALSSR^-OH
Peptide H-MVTGVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is used as building blocks in the synthesis of peptide derivatives, such as amines, alcohols, thiols, and other amino acids. This resin has been shown to be stable in aqueous or organic solvents.
Degré de pureté :Min. 95%H-ADLSGITGAR^-OH
Peptide H-ADLSGITGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C66H97N12O24PMasse moléculaire :1,473.57 g/molSRC Kinase Substrate
Peptide SRC Kinase Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formule :C64H107N22O24PMasse moléculaire :1,599.69 g/molAc-PWRPSHPVWMPT-NH2
Peptide Ac-PWRPSHPVWMPT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Masse moléculaire :1,531.8 g/molAc-CVYVRSAIQLGNYK-OH
Peptide Ac-CVYVRSAIQLGNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGVNGFGR^-OH
Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-YGGFL-OH
Peptide Boc-YGGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C13H24N4O6S1Masse moléculaire :364.42 g/molH2N-Thr-Pro-Pro-Ala-Pro-Lys-pThr-Pro-Pro-Ser-Ser-G
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C71H115N18O26P1Masse moléculaire :1,672.23 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGTQFIR^-OH
Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Glu4]-Oxytocin
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C43H65N11O13S2Masse moléculaire :1,008.17 g/molCMVpp65 - 34 (SAAERKHRHLPVADA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,657.9 g/molH-HSDPVWQVK^-OH
Peptide H-HSDPVWQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLQWAKKGYYTMKSN-NTBiot
Peptide H-VLQWAKKGYYTMKSN-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNILNNK^-OH
Peptide H-LNILNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLASVSTVLTSK^-OH
Peptide H-FLASVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGDNNL^TRIVGGQE-OH
Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLFSVHWPPLKA-NTBiot
Peptide H-YLFSVHWPPLKA-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ARTKQTARKSTGGKAPRKQLY-NH2
Peptide H-ARTKQTARKSTGGKAPRKQLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AYPDANLLNDR^-OH
Peptide H-AYPDANLLNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLYANTVL^SGGTTMYPGIADR-OH
Peptide H-DLYANTVL^SGGTTMYPGIADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MHRQETVDCLKKFN-NH2
Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAGFNLLMTLR^-OH
Peptide H-VAGFNLLMTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWV^AEI^R-OH
Peptide H-GLEWV^AEI^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALAAELNQLR^-OH
Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Arg-Glu-Gly-Val-Glu-Leu-Cys-Pro-Gly-Asn-Lys-Tyr-Gl
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C132H212N44O41S2Masse moléculaire :3,135.5 g/molH-LTVLGQPK^-OH
Peptide H-LTVLGQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Antihypertensive peptide ITTNP
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C23H40N6O9Masse moléculaire :544.6 g/molH-RLLFRKIRRLKR-NH2
Peptide H-RLLFRKIRRLKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KFVAAWTL-NH2
Peptide Ac-KFVAAWTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAINNGVR^-OH
Peptide H-NAINNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SQIFSTASDNQPTVTIK^-OH
Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIGQGQQPSTAAR^-OH
Peptide H-VIGQGQQPSTAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVNEEAL^R-OH
Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSVLTVLHQDWL^NGK^-OH
Peptide H-VVSVLTVLHQDWL^NGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLFRAVITK^-OH
Peptide H-SLFRAVITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGAGDVAFV^K-OH
Peptide H-DGAGDVAFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ETEVIDPQDLLEGR^-OH
Peptide H-ETEVIDPQDLLEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RF^F-OH
Peptide H-RF^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C51H85N11O12SMasse moléculaire :1,076.35 g/molAc-QEQLERALNSS-OH
Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AHYDLR^-OH
Peptide H-AHYDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Indole-D-OH
Peptide Indole-D-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CMPEEGFKGTGLLGH-OH
Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPALEDL^R-OH
Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNMLNNNYK^-OH
Peptide H-LNMLNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGFPWSEIR^-OH
Peptide H-IGFPWSEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Asp371]-Tyrosinase (369-377), human
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C42H66N10O16S2Masse moléculaire :1,031.2 g/molH-ENPVVHFFKNIVTPR-NH2
Peptide H-ENPVVHFFKNIVTPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVTVTAEALR^-OH
Peptide H-FVTVTAEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-I^PGMVVDR-OH
Peptide H-I^PGMVVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melanotan I
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C78H111N21O19Masse moléculaire :1,646.9 g/molH-TNLESILSYPK^-OH
Peptide H-TNLESILSYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
OVA peptide (257-264) TFA salt
CAS :Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (257-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb. Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.
Sold as the TFA saltFormule :C45H74N10O13·xC2HF3O2Couleur et forme :PowderMasse moléculaire :963.13 g/molAc-CAQK-NH2
Peptide Ac-CAQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBcAg (HBV) (18 - 27)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C580H78N10O15Masse moléculaire :1,155.3 g/molH-AGAVAEEVLAAIR^-OH
Peptide H-AGAVAEEVLAAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTWASHEK^-OH
Peptide H-LTWASHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^IFDANAPV^AV^R^-OH
Peptide H-V^IFDANAPV^AV^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YML^DLQPETT-OH
Peptide H-YML^DLQPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVEPSDTIENV^K-OH
Peptide H-TITLEVEPSDTIENV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 14 (PSLILVSQYTPDSTP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,617.8 g/molH-DLAFPGSGEQVEK^-OH
Peptide H-DLAFPGSGEQVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Suc-Ala-Ala-Pro-Abu-pNA
Suc-Ala-Ala-Pro-Abu-pNA is a peptide that has been shown to inhibit the activity of elastase, an enzyme that breaks down proteins in tissues. It is used as a substrate for enzyme assays and as a tool for studying elastase. This peptide can be used to study the structure and function of elastases, which are necessary for the breakdown of proteins in tissues.
Formule :C25H34N6O9Degré de pureté :Min. 95%Masse moléculaire :562.58 g/molMYH9 741-749 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-LGPGQSKVIG-NH2
Peptide H-LGPGQSKVIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIQELGLDK^-OH
Peptide H-VIQELGLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2
Peptide H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVAAPSVFIFPPSDEQLK^-OH
Peptide H-TVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-E-boro-Pro-OH
Peptide H-E-boro-Pro-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Glu1] Fibrinopeptide B, human
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C66H95N19O26Masse moléculaire :1,570.6 g/molH-GAIIGLMV^GG-OH
Peptide H-GAIIGLMV^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MHC I-Strep HLA-A*0201 Prame
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-ALQHLMDKWMAM-NH2
Peptide Ac-ALQHLMDKWMAM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TTAVTRPVETHELIR^-OH
Peptide H-TTAVTRPVETHELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 63 (DVEEDLTMTRNPQPF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,792 g/molH-SVINDPIYK^-OH
Peptide H-SVINDPIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGLLLHDSIQIPR^-OH
Peptide H-LGLLLHDSIQIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2
Peptide Ac-KLLKLLLKLLKLLLKLLLKLLK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gly-Ile-Pro-Val-His-Leu-Glu-Leu-Ala-Ser-Met-Thr-As
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C137H221N35O41S3Masse moléculaire :3,110.63 g/molTAMRA-QKRPSQRSKYL-OH
Peptide TAMRA-QKRPSQRSKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYLPAV^DEK-OH
Peptide H-TYLPAV^DEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.M617
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C112H161N29O28Masse moléculaire :2,361.68 g/mol
