CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

29793 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2


    Peptide H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47181

    ne
    À demander
  • H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2


    Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49525

    ne
    À demander
  • Ac-RLR-[AMC] Proteasome Substrate


    Fluorogenic substrate peptide to assay trypsin-like activity. In its intact state this peptide is non-fluorescent, however when aminomethylcoumarin (AMC) is released upon hydrolysation, fluorescence can be detected. This peptide is therefore a useful tool for analysing trypsin-like enzyme activity.AMC is a fluorescent dye with excitation maxima at around 360 nm and emission maxima at around 450 nm. AMC can be excited with a mercury lamp and observed using a UV filter set.
    Masse moléculaire :642.4 g/mol

    Ref: 3D-CRB1100438

    1mg
    470,00€
    100µg
    346,00€
    500µg
    386,00€
  • Ac-SADTNKRKRDEGIQESPVC-NH2


    Peptide Ac-SADTNKRKRDEGIQESPVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45131

    ne
    À demander
  • HLA leader peptide LVL (heavy-labeled)


    Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40.  When presented on a cell surface via HLA-E molecules, the HLA-peptide complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack.Peptide H-VMAPRTLL^-OH is a heavy-labeled version of PP45242, and is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48718

    ne
    À demander
  • H-DLDLEMLAPYIPMDDDFQLR-OH


    Peptide H-DLDLEMLAPYIPMDDDFQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C107H162N24O34S2
    Masse moléculaire :2,410.72 g/mol

    Ref: 3D-PP51245

    1mg
    202,00€
    5mg
    378,00€
  • H-HLMSFPQSA-OH


    Peptide H-HLMSFPQSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C45H66N12O12S
    Masse moléculaire :1,017.16 g/mol

    Ref: 3D-PP51269

    1mg
    202,00€
    5mg
    378,00€
  • Biotin-PEG2-Claudin-9


    Biotin-PEG2-Claudin-9 is derived from the tight junction protein Claudin-9 which is encoded by the CLDN6 gene and can be found within epithelial cell to cell contacts. Structurally, the Claudin family, of which Claudin-9 is a member, are transmembrane proteins containing two extracellular loops and are involved in maintaining cell polarity and controlling paracellular ion flux.Reduction in the number of Claudins has been associated with tumour formation. This may be due to Claudin role in maintaining cell detachment and migration.Claudin-9 has been shown to be overexpressed in hepatocellular carcinoma (HCC) and has the ability to increase the metastasis of hepatocytes. It further influences the activation of the Stat3 signalling pathway through tyrosine kinase 2. Overall CLDN9 demonstrates itself to be a HCC proto-oncogene.This peptide has a covalently bonded N-terminal Biotin tag that can be used for detection and purification and contains a polyethylene glycol spacer (PEG2).
    Couleur et forme :Powder
    Masse moléculaire :2,881.5 g/mol

    Ref: 3D-CRB1000357

    1mg
    282,00€
    500µg
    206,00€
  • H-ISTLNSHNLPILR^-OH


    Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40973

    ne
    À demander
  • ACTH (7-38) Human


    Segment 7-38 of adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed. ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.
    Masse moléculaire :3,659.11 g/mol

    Ref: 3D-CRB1000078

    1mg
    470,00€
    500µg
    386,00€
  • (Trp63,Trp64)-C3a (63-77)

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C86H134N26O18
    Masse moléculaire :1,820.17 g/mol

    Ref: 3D-PP50252

    ne
    À demander
  • SIVmac239 - 35


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,621.9 g/mol

    Ref: 3D-PP50360

    ne
    À demander
  • Pantinin-2


    Pantinin-2, like other pantinin peptides, has high activity against Gram-positive bacteria yet weak activity against Gram-negative bacteria. Pantinin-2 also displays activity against Candida tropicalis and has relatively mild haemolytic activity against human red blood cells.
    Couleur et forme :Powder
    Masse moléculaire :1,403.8 g/mol

    Ref: 3D-CRB1000540

    1mg
    282,00€
    500µg
    206,00€
  • Fmoc-Lys(Palmitoyl-Glu-OtBu)-OH

    CAS :
    This is a building block for peptide synthesis. It is a protected lysine derivative that can be used in the formation of peptides. This functionalized lysine derivative can be deprotected and reacted with other amino acids to form peptides. The protecting group, Fmoc, protects the lysine from unwanted reactions during the synthesis process. The side chain, Palmitoyl-Glu-OtBu, allows for the attachment of other molecules to the lysine side chain.
    Formule :C46H69N3O8
    Degré de pureté :Min. 95%
    Masse moléculaire :792.08 g/mol

    Ref: 3D-KEP-1957-PI

    1g
    465,00€
    5g
    1.471,00€
  • pHLIP WT


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :4,525.87 g/mol

    Ref: 3D-PP50437

    ne
    À demander
  • HPV16 E6 pep11**m


    HPV16 E6 pep11**m.

    Couleur et forme :Powder
    Masse moléculaire :2,069.2 g/mol

    Ref: 3D-CRB1000428

    1mg
    282,00€
    500µg
    206,00€
  • Hp1404


    Antimicrobial peptides (AMP) are proving a lucrative area for antibiotics in the era of bacterial resistance. Of note, the scorpion Heterometrus petersii was found to produce Hp1404, an amphipathic cationic peptide with specific activity against Gram-positive bacteria- Hp1404 was shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA). The mode of action is by membrane penetration and disruption. MRSA did not gain resistance after several exposures to Hp1404 suggesting it may be a key agent against the rise of antibiotic resistance. Importantly, bacterial lethality was maintained with low toxicity to mammalian cells. Hp1404 is being used to generate analogues with reduced toxicity to mammalian cells and improved antimicrobial potency against a wider range of organisms.
    Couleur et forme :Powder
    Masse moléculaire :1,544.9 g/mol

    Ref: 3D-CRB1000537

    1mg
    282,00€
    500µg
    206,00€
  • H-IIVPLNNR^-OH


    Peptide H-IIVPLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42101

    ne
    À demander
  • H-TGWLGPFDYWGQGTLVTVSSASTK-OH


    Peptide H-TGWLGPFDYWGQGTLVTVSSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C118H170N28O35
    Masse moléculaire :2,558.79 g/mol

    Ref: 3D-PP51322

    1mg
    202,00€
    5mg
    378,00€
  • Influenza Virus Nucleoprotein (311 - 325)


    The Influenza Virus Nucleoprotein (311 - 325) is a component of the viral ribonucleotide complex, derived from the influenza virus and it is involved in viral replication, RNA packing and nuclear trafficking. As a monomer it contains basic residues which allow it to bind to single stranded RNA and through its flexible tail loop it has the ability to form NP oligomers.Furthermore NP is able to support the viral polymerase structurally, through associating with the two subunits PB1 and PB2, and it allows the viral ribonucleotide complex to be transported in and out of the nucleus due to its nuclear localisation and nuclear export signals.During influenza viral replication messenger RNA, viral genome RNA and complementary positive-sense RNA are produced and NP is crucial for this replication.Inhibitors of NP have potential to be used to prevent the influenza virus in humans.
    Masse moléculaire :1,764.9 g/mol

    Ref: 3D-CRB1000694

    1mg
    282,00€
    500µg
    206,00€
  • GRP (18-27) (human, porcine, canine)


    Mammalian bombesin-like neuropeptide first isolated from pig spinal cord, which can stimulate rat uterine smooth muscle contraction and gastrin and somatostatin secretion in vitro. Increases blood pressure and pancreatic exocrine secretion in dogs.
    Couleur et forme :Powder
    Masse moléculaire :1,119.5 g/mol

    Ref: 3D-CRB1000568

    1mg
    282,00€
    500µg
    206,00€
  • Fibromodulin F1 7-17 (HLA-A*02:01)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50740

    ne
    À demander
  • H-RGFFYTPK^T-OH


    Peptide H-RGFFYTPK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43391

    ne
    À demander
  • LCBiot-DAEFRHDSGYEVHHQ-OH


    Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45598

    ne
    À demander
  • SIVmac239 - 19


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,785.1 g/mol

    Ref: 3D-PP50882

    ne
    À demander
  • H-ALPAPIEK^TISK-NH2


    Peptide H-ALPAPIEK^TISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41461

    ne
    À demander
  • H-ESTLHLVLR^-OH


    Peptide H-ESTLHLVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41919

    ne
    À demander
  • [5-FAM] EGFR/kinKDR peptide substrate


    Peptide substrate of the epidermal growth factor receptor (EGFR), a member of the receptor tyrosine kinase family known as ErbBs or HER receptors. These receptors are involved in the regulation of cell proliferation, survival, differentiation and migration. When these receptors are dysregulated many diseases, including cancer, can arise.Binding to the ligand binding domain of the EGFR causes receptor dimerization. This is sequentially followed by the tyrosine kinase domain being activated and the tyrosine residues on the C-terminal tail of the receptor becoming phosphorylated, activating downstream signalling pathways.This peptide contains an N-terminal 5-Carboxyfluorescein (5-FAM) moiety, a widely used green fluorescent tag.
    Masse moléculaire :1,978.9 g/mol

    Ref: 3D-CRB1101428

    1mg
    386,00€
    500µg
    282,00€
  • Fmoc-Trp(Boc)-Rink-Amide MBHA Resin


    Please enquire for more information about Fmoc-Trp(Boc)-Rink-Amide MBHA Resin including the price, delivery time and more detailed product information at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-RFW-10033-PI

    1g
    298,00€
    5g
    936,00€
  • [Pyr]-Apelin-13

    CAS :
    [Pyr1]-Apelin-13 acts as a ligand for the apelin receptor (APJ) G protein-coupled receptor and is a substrate for angiotensin-converting enzyme 2. Apelin is a member of the adipokine hormone family from adipose tissue. Adipokines are involved in processes such as vascular homeostasis and angiogenesis.Apelin and the apelin receptor are widely distributed throughout the body. Apelin is associated with cardiovascular diseases, obesity, diabetes and cancer. Apelin is expressed in the spinal cord and the human brain. Immunohistochemistry shows that apelin-17 is significantly expressed in the human heart, brain, lungs and endothelial cells. Studies show myocardial infarction apelin mRNA expression is greater during human heart failure than in healthy tissue. Apelin protects against heart failure due to the pyroglutamic form of apelin, [Pyr1]-Apelin-13, which decreases infarct size of myocardial infarctions. Furthermore, rats with hypertension have reduced levels of apelin and APJ. [Pyr1]-Apelin-13 exhibits higher APJ agonist potency than Apelin-13. We also have the alternative available.
    Formule :C69H108N22O16S
    Couleur et forme :Powder
    Masse moléculaire :1,533.8 g/mol

    Ref: 3D-CRB1000443

    1mg
    282,00€
    500µg
    206,00€
  • Pep - 1: Chariot


    Pep-1 is a synthetic cell-penetrating peptide (CPP), and has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive manner. It is a CPP with primary amphipathicity, which results from its amino acid sequence as opposed to its folding structure. The primary structure of Pep-1: Chariot comprises three main domains: a tryptophan-rich, hydrophobic domain, and a hydrophilic domain derived from an NLS (nuclear localisation signal) of SV40 (simian virus 40) large T-antigen, and a spacer.

    Couleur et forme :Powder
    Masse moléculaire :2,846.5 g/mol

    Ref: 3D-CRB1001134

    1mg
    282,00€
    500µg
    206,00€
  • H-ADFLEQPVLGFVR^^-OH


    Peptide H-ADFLEQPVLGFVR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46398

    ne
    À demander
  • H-Phe-Ser-Leu-Leu-Arg-Tyr-NH2

    CAS :
    This is a synthetic peptide that was originally isolated from human colon tissue. It has been shown to sensitize dorsal root ganglia neurons in vitro, producing a response to the neurotransmitter acetylcholine. This peptide also induces apoptosis in neuronal cells and increases the permeability of blood vessels in tissues by activating vasoactive intestinal peptide (VIP) receptors. The effects of this peptide were studied in humans with bowel disease or inflammatory bowel disease. It was found that it may be effective for treating these diseases as well as necrosis factor-mediated inflammation. This peptide is also known to activate IL-10, which is an anti-inflammatory cytokine.
    Formule :C39H60N10O8
    Degré de pureté :Min. 95%
    Masse moléculaire :796.98 g/mol

    Ref: 3D-PAR-3888-PI

    1mg
    171,00€
    5mg
    485,00€
  • SARS-CoV-2 NSP13 (226-240)


    The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (226-240) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Masse moléculaire :1,565.9 g/mol

    Ref: 3D-CRB1001767

    1mg
    282,00€
    500µg
    206,00€
  • H-SQVETEDLILKPGVVHVIDIDR-OH


    Peptide H-SQVETEDLILKPGVVHVIDIDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C109H181N29O35
    Masse moléculaire :2,475.79 g/mol

    Ref: 3D-PP51318

    1mg
    202,00€
    5mg
    378,00€
  • Ac-KVPRNQDWL-OH


    Peptide Ac-KVPRNQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44976

    ne
    À demander
  • Biot-RDVYEEDSYVKRSQG-NH2


    Peptide Biot-RDVYEEDSYVKRSQG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45843

    ne
    À demander
  • NAP


    Peptide NAP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C36H60N10O12
    Masse moléculaire :824.94 g/mol

    Ref: 3D-PP44309

    ne
    À demander
  • Ac-PCH-NH2


    Peptide Ac-PCH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46668

    ne
    À demander
  • Herceptide


    Herceptide

    Masse moléculaire :1,698.8 g/mol

    Ref: 3D-CRB1001738

    1mg
    282,00€
    500µg
    206,00€
  • H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe-NH2

    CAS :
    H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe is a peptide that is activated by incubation with collagen. It has been shown to have an inhibitory effect on thrombin receptor and the activation of coagulation factors, which may be due to its ability to desensitize the receptor. HSLRAPAP can also be used in cancer therapy. In animal studies, it has been shown to inhibit tumor growth and metastasis. HSLRAPAP has also been shown to stimulate the production of platelets in animals, which may account for its antiplatelet properties.
    Formule :C83H120F3N21O24
    Degré de pureté :Min. 95%

    Ref: 3D-PAR-3935-PI

    1mg
    141,00€
    5mg
    454,00€
  • H-SVINASAAIAPK^-OH


    Peptide H-SVINASAAIAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44745

    ne
    À demander
  • H-R^R^-OH


    Peptide H-R^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40641

    ne
    À demander
  • H-SL^YNTVATL-OH


    Peptide H-SL^YNTVATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41703

    ne
    À demander
  • H-SNL-NH2


    Peptide H-SNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48575

    ne
    À demander
  • LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2


    Peptide LCBiot-GSGSSRGGSGSGGSGGGGSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46632

    ne
    À demander
  • SARS-CoV-2 NSP13 (551-565)


    The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (551-565) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Masse moléculaire :1,673.8 g/mol

    Ref: 3D-CRB1001817

    1mg
    282,00€
    500µg
    206,00€
  • Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2


    Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45162

    ne
    À demander
  • TKD (450-463)


    Heat shock proteins (Hsps) are highly conserved and stress inducible. Hsp70 has been found in tumour cell lines to be highly expressed with a higher plasma membrane localisation. This is correlated to the cell sensitivity to natural killer (NK) cell-mediated lysis. Investigation identified that Hsp70 N-terminal extended peptide TKD (450-463) was critical for this to occur. TKD (450-463) with low dose interleukin (IL-2) has the same capacity to induce NK cell proliferation and activity as the full-length protein Hsp70. Excess of Hsp70 and TKD (450-463) both inhibit cytolytic activity by NK cells. Other related sequences tested did not lead to NK cell-mediated lysis. Further study with the TKD (450-463) epitope could elucidate how NK cells are activated by Hsp70s as the mechanism remains unclear.
    Masse moléculaire :1,562.8 g/mol

    Ref: 3D-CRB1001545

    1mg
    282,00€
    500µg
    206,00€
  • H-Ser-Phe-Leu-Leu-Arg-OH

    CAS :
    H-Ser-Phe-Leu-Leu-Arg-OH is a cyclic peptide that has been shown to have cytotoxic effects against cells of the atherosclerotic lesion in vivo. It also has antioxidant properties and can be used as a biocompatible polymer for the treatment of autoimmune disease. This drug is not potent enough to be used as an antibacterial agent but is effective against some strains of Mycobacterium tuberculosis and Mycobacterium avium complex. This drug binds to integrin receptors on cells, which may account for its low potency.
    Formule :C30H50N8O7
    Degré de pureté :Min. 95%
    Masse moléculaire :634.77 g/mol

    Ref: 3D-PAR-3936-PI

    1mg
    141,00€
    5mg
    454,00€
  • H-K^IADYNYKL-OH


    Peptide H-K^IADYNYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49309

    ne
    À demander
  • 5TAMRA-QEPEPPEPFEYIDD-OH


    Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48938

    ne
    À demander
  • H-TKEGVLYVGSK^-OH


    Peptide H-TKEGVLYVGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42637

    ne
    À demander
  • [Aurora™ Fluor 647]-RGD peptide


    The RGD motif has been found in wide range of eukaryotic proteins allowing cell adhesion to the ECM. The tripeptide RGD is the primary domain to bind integrin found in extracellular matrix (ECM) proteins including fibronectin, fibrinogen and osteopontin. It has been shown to effectively adhere various cell types to a wide range of biomaterials. This is a key research tool in the flourishing area of tissue engineering and wound healing using synthetic peptides that are either inert or can be potentially beneficial. RGD is a suitable ligand for targeting nanomolecules and cancer drugs to specific tissues due to its biocompatibility and safety.This RGD peptide is supplied with an Aurora Fluor 647 fluorophore attached and produced to research grade quality. Aurora Fluor 647 excitation suited to 594nm and emission peaked at 671nm. The Molecular Probes Alexa Fluor dyes provide a number of benefits including: more intense fluorescence than other spectrally similar conjugates better photostability, allowing more time for image capture availability of conjugates in an array of distinct fluorescent colours from blue to infrared- and pH insensitivity that enables the dyes to remain highly fluorescent over a broad pH range and high water solubility.
    Couleur et forme :Powder

    Ref: 3D-CRB1101636

    100µg
    386,00€
    500µg
    470,00€
  • LCBiot-LDPD-OH


    Peptide LCBiot-LDPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43413

    ne
    À demander
  • H-VLGSGAFGTVYK^-OH


    Peptide H-VLGSGAFGTVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42171

    ne
    À demander
  • BQ-123 Sodium Salt

    CAS :
    BQ-123 is a cyclic peptide that blocks the endothelin-A receptor. It has been shown to be an effective treatment for pain and inflammation associated with osteoarthritis, rheumatoid arthritis, and other inflammatory conditions. BQ-123 binds to the endothelin-A receptor, which is located on the surface of cells in many tissues throughout the body. When bound, it inhibits intracellular calcium concentrations by reducing voltage-gated calcium channels and prevents the release of neurotransmitters. BQ-123 also has a stabilizing effect on hydrogen bonds due to its charged side chains. This property may account for its ability to form stable complexes with other proteins, inhibiting their function. BQ-123 has been shown to have an active binding site on cyclic AMP response element binding protein (CREB) that inhibits CREB activity, thereby reducing protein synthesis. It also blocks cyclic GMP (cGMP)-dependent protein kin
    Formule :C31H42N6O7
    Degré de pureté :Min. 95%
    Masse moléculaire :610.70 g/mol

    Ref: 3D-PED-3512-PI

    1mg
    169,00€
    5mg
    403,00€
  • Lasioglossin-III


    Lasioglossin-III (Lasio-III) is a naturally-occurring salt-resistant anti-microbial peptide (AMP) found in-Lasioglossum laticeps-(broad-faced furrow bee). Lasioglossin-III has broad spectrum anti-microbial activity and anti-biofilm properties against Gram negative and Gram positive bacteria, including strong anti-microbial activity against-E. coli,-S. aureus, and-P aeruginosa-under physiological salt concentration, with low toxicity.AMPs form an important part of the innate immune system in plants, animals and insects-and are reported to be effective even against several antibiotic resistant strains due to differing modes of pathogen killing from those of conventional antibiotics. Lasio-III has a membranolytic mode of action. It can bind both the outer and inner membranes of bacteria. Lasio-III possesses a fast killing ability toward both Gram positive and negative bacteria compared to many other active AMPs.
    Masse moléculaire :1,764.2 g/mol

    Ref: 3D-CRB1001494

    1mg
    282,00€
    500µg
    206,00€
  • δ Sleep Inducing Peptide


    Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Formule :C35H48N10O15
    Masse moléculaire :848.83 g/mol

    Ref: 3D-PP46475

    ne
    À demander
  • H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH


    Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42449

    ne
    À demander
  • Ala-AMC

    CAS :
    Ala-AMC is a fluorescent peptide that binds to the receptor AMPA and activates it. This product is used in research as a tool for studying protein interactions, cellular biology and pharmacology.
    Formule :C13H14N2O3
    Degré de pureté :Min. 95%
    Masse moléculaire :246.26 g/mol

    Ref: 3D-MAM-3147-V

    5mg
    182,00€
  • Fluor-QEDIIRNIARHLAQVGDSMDR-OH


    Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45928

    ne
    À demander
  • Ac-CSIVDSGTTN-OH


    Peptide Ac-CSIVDSGTTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45121

    ne
    À demander
  • [5-FAM]-VGB4


    Antagonist peptide of VEGF-A and VEGF-B reproducing two binding regions of VEGF-B (loop 1 and loop3) linked together by a receptor binding region of VEGF-A (loop3). Binds to both VEGFR1 and VEGFR2 and inhibits VEGF-A driven proliferation, migration and tube formation in HUVECs. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Masse moléculaire :3,066.5 g/mol

    Ref: 3D-CRB1101542

    1mg
    386,00€
  • H-DLAFPGSGEQVEK^-OH


    Peptide H-DLAFPGSGEQVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47785

    ne
    À demander
  • [5-FAM]/[Lys(Dabcyl)]-CoV Main Protease (Mpro) Substrate


    FRET peptide substrate for the severe acute respiratory syndrome coronavirus main protease (SARS-CoV Mpro). The substrate sequence is derived from residues P4-P5' of the SARS-CoV Mpro N-terminal autoprocessing site which has the sequence AVLQSGFRK. SARS-CoV Mpro is a key antiviral target.This peptide contains an N-terminal 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag and the Dabcyl fluorescence quencher. When the peptide is intact, fluorescence is undetectable due to the proximity of the Dabcyl quencher to the 5-FAM fluorophore. However upon cleavage of the peptide by SARS-CoV Mpro, the 5-FAM group and the Dabcyl quencher are separated and fluorescence can be detected. This therefore represents a useful tool for investigating SARS-CoV Mpro activity.
    Couleur et forme :Powder
    Masse moléculaire :1,740.8 g/mol

    Ref: 3D-CRB1101508

    1mg
    651,00€
    500µg
    470,00€
  • H-LFDQAFGVPR^-OH


    Peptide H-LFDQAFGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40183

    ne
    À demander
  • H-FITLVPSNLPHEATR^-OH


    Peptide H-FITLVPSNLPHEATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44995

    ne
    À demander
  • EBV BRLF1 (28-37) (HLA-A24)


    Portion of EBV RTA
    Masse moléculaire :1,243.6 g/mol

    Ref: 3D-CRB1001458

    1mg
    282,00€
    500µg
    206,00€
  • Thrombin Receptor Antagonist


    Thrombin is the main effector of the coagulation cascade- it is a serine protease. Thrombin binds to active protease activated receptor 1 (PAR-1) which belongs to a subfamily of G-protein coupled receptors (GPCR). However, thrombin generated during cardiopulmonary bypass can activate PAR-1 leading to platelet dysfunction and unwanted bleeding. FLLRN is found to be a potent PAR-1 antagonist. Use of FLLRN and variants has aided the study of platelet aggregation dynamics. Further study may provide a suitable clinical application.
    Masse moléculaire :661.4 g/mol

    Ref: 3D-CRB1000557

    1mg
    206,00€
    5mg
    386,00€
    500µg
    136,00€
  • Ac-Tyr-Val-Gly

    CAS :
    Ac-Tyr-Val-Gly is a mitochondrial protein that regulates mitochondrial functions and is involved in the regulation of apoptosis. Ac-Tyr-Val-Gly interacts with nuclear DNA and regulates transcription, translation, and replication. Ac-Tyr-Val-Gly has been shown to be toxic to liver cells; however, it has been shown to have no effect on neuronal death or apoptosis pathway. These effects may be due to its ability to induce proteolytic activity in neurons and its ability to activate proapoptotic proteins such as Bax.
    Formule :C18H25N3O6
    Degré de pureté :Min. 95%
    Masse moléculaire :379.41 g/mol

    Ref: 3D-SYG-3146

    1g
    1.124,00€
    10g
    2.925,00€
    25g
    3.961,00€
    100mg
    373,00€
  • Ac-CA-NH2


    Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45187

    ne
    À demander
  • H-IVGG-NH2


    Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49614

    ne
    À demander
  • Fmoc-Ile-OH


    Peptide Fmoc-Ile-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46557

    ne
    À demander
  • [Azhx]-ANP (Human)


    ANP (human) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in cardiovascular remodelling.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in pro-ANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.At the N-terminus Azhx, 6-azidohexanoic acid, is present.

    Masse moléculaire :3,219.5 g/mol

    Ref: 3D-CRB1000609

    1mg
    470,00€
    500µg
    386,00€
  • TAT-NR2B (C-ter)


    N-methyl-D-aspartate receptors (NMDARs) are ligand-gated ionotropic glutamate receptors that mediate excitatory synaptic transmission and play important roles in many aspects of nervous system function including: synaptic plasticity- learning and memory- neuronal development and circuit formation. NMDARs have been implicated in various neuronal disorders. NMDARs are heteromers consisting of an obligate NR1 subunit and most commonly one or two kinds of NR2 subunits or occasionally NR3 subunits. NR2B is the predominant subunit found in the postnatal brain, however over time the number of NRA2 subunits increase and eventually outnumber NR2B subunits in a process known as the NR2B-NR2A developmental switch. The greater ratios of the NR2B subunit in post-natal brains leads to NMDA receptors which remain open longer compared to those with more NR2A subunits, this may be related to the greater memory abilities in the immediate postnatal period compared to late in life. NR2B improves synaptic plasticity and memory when over-expressed in neurones. The involvement of NMDAR in the central nervous system (CNS) has become a focus area for neurodegenerative diseases such as Alzheimer's disease, epilepsy and ischemic neuronal cell death.The TAT peptide is present due to its properties as a cell penetrating cationic peptide (CPP). It derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). As a CPP, TAT is able facilitate the delivery of NR2B (C-ter) across the plasma membrane.
    Couleur et forme :Powder
    Masse moléculaire :2,517.4 g/mol

    Ref: 3D-CRB1000541

    1mg
    282,00€
    500µg
    206,00€
  • Fmoc-Cys(Pam)2-OH

    CAS :

    Fmoc-Cys(Pam)2-OH is a building block that can be used in the synthesis of lipopeptides. It is used in the research of vaccines and has been shown to target tumor cells.

    Formule :C53H83NO8S
    Degré de pureté :Min. 95%
    Masse moléculaire :894.32 g/mol

    Ref: 3D-FCP-5001-PI

    1g
    1.961,00€
    5g
    À demander
  • H-AQDFVQWL^MNT-OH


    Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42601

    ne
    À demander
  • TAT-TRPV1 (736-745)


    TAT-TRPV1 (736-745) is a cell-permeable TRPV1 fragment (capsaicin receptor and the vanilloid receptor 1), that can inhibit the interaction of TRPV1 and A-kinase anchoring protein 79 (AKAP79). TAT- TRPV1 (736-745) consists of amino acids 736-749 from the TRPV1 C-terminal domain, combined with amino acids 47-57 of TAT to promote uptake across neuronal cell membranes. TAT-TRPV1 (736-745) inhibits both the first and the second phase of pain behaviour in the formalin test, implying an effect on both acute and inflammatory pain.A-kinase anchoring protein 79 (AKAP79) is a protein that targets kinases to TRPV1. Inflammation causes hyperalgesia but can be reduced when TRPV1 is blocked. a key region on AKAP79, amino acids 326-336, is responsible for its interaction with TRPV1. TAT-TRPV1 (736-745) promotes uptake across the cell membrane and TRPV1 (736-745)  inhibited inflammatory hyperalgesia in mice. TAT-TRPV1 (736-745) did not affect pain thresholds in the absence of inflammation. These results suggest that antagonizing the TRPV1-AKAP79 interaction will be a useful strategy for inhibiting inflammatory hyperalgesia and TAT is an effective delivery system.

    Masse moléculaire :2,927.6 g/mol

    Ref: 3D-CRB1001171

    1mg
    282,00€
    500µg
    206,00€
  • PEN-FFW


    Sal-like4 (SALL4) derived peptide able to antagonise the SALL4-NuRD complex in hepatocellular carcinoma, turning SALL4 from a dual transcription repressor-activator to a singular transcription activator. Displays antitumour effects in xenograft mouse models.
    Couleur et forme :Powder

    Ref: 3D-CRB1001353

    1mg
    282,00€
    5mg
    633,00€
    500µg
    206,00€
  • HXB2 gag NO-114


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,599.7 g/mol

    Ref: 3D-PP50337

    ne
    À demander
  • [5-FAM] Kemptide


    Kemptide is a synthetic substrate of the PKA catalytically active subunit (PKAc), and can bind along with ATP to PKAc. It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

    Masse moléculaire :1,129.5 g/mol

    Ref: 3D-CRB1001375

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • H-WLSLLVPFV^-OH


    Peptide H-WLSLLVPFV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41137

    ne
    À demander
  • Peptide WE-14

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C72H116N18O24S
    Masse moléculaire :1,649.9 g/mol

    Ref: 3D-PP50088

    ne
    À demander
  • H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH


    Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41603

    ne
    À demander
  • TAT-Beclin Scrambled


    TAT-Beclin Scrambled is a scrambled version of the peptide derived from a region of the Beclin 1 protein. The original peptide interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.The scrambled sequence in this peptide means it can be used as an effective negative control in such experiments because whilst it contains the same amino acids as Beclin-1 (and thus has the same molecular weight), it does not express the same properties as the original peptide.TAT (47-57) is present due to its properties as a cell penetrating cationic peptide (CPP). It derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). As a CPP, TAT (47-57) is able facilitate the delivery of the Beclin Scrambled protein across the plasma membrane.This peptide contains a GG linker between the C-terminus of TAT (47-57) and the N-terminus of Beclin Scrambled.
    Couleur et forme :Powder
    Masse moléculaire :3,738.9 g/mol

    Ref: 3D-CRB1000911

    1mg
    282,00€
    500µg
    206,00€
  • H-NQVSLTCLVK^-OH


    Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48120

    ne
    À demander
  • CART (Human, 55-102)

    CAS :
    CART is a peptide that acts as an activator for the CART receptor. It has been shown to be a ligand for the CART receptor and blocks calcium channels in cell culture. It is a potent inhibitor of ion channels, which are proteins that allow ions to pass through the membrane of cells. CART is also used as a research tool in cell biology, pharmacology, and life science.
    Formule :C225H365N65O65S7
    Degré de pureté :Min. 95%
    Masse moléculaire :5,245.2 g/mol

    Ref: 3D-PCA-4350-S

    100µg
    1.181,00€
  • H-DVKPSNILVNSR-OH


    Peptide H-DVKPSNILVNSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C57H98N18O18
    Masse moléculaire :1,341.51 g/mol

    Ref: 3D-PP51249

    1mg
    202,00€
    5mg
    378,00€
  • CMVpp65 - 95 (GKLEYRHTWDRHDEG)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,899 g/mol

    Ref: 3D-PP50898

    ne
    À demander
  • H-LEEQAQQIR^-OH


    Peptide H-LEEQAQQIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40357

    ne
    À demander
  • H-NNHTASILDR^-OH


    Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42391

    ne
    À demander
  • FdM


    FdM, ferredoxin maquette is a synthetic peptide which can bind a [4Fe-4S] cluster and contains a bacterial ferredoxin consensus motif (CIACGAC).
    Masse moléculaire :1,525.6 g/mol

    Ref: 3D-CRB1001003

    1mg
    282,00€
    500µg
    206,00€
  • LCBiot-IAGEASRLAHYNKRSTITSR-OH


    Peptide LCBiot-IAGEASRLAHYNKRSTITSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45915

    ne
    À demander
  • Lactacystin

    CAS :
    Lactacystin is a peptide that acts as an activator of ion channels. It binds to the receptor and activates the ligand-gated ion channel, which then opens the ion channel. This leads to increased influx of ions into the cell and an increase in intracellular calcium concentration. Lactacystin has been used as a research tool for studies on protein interactions, such as antibody-antigen interactions and receptor-ligand interactions. Lactacystin is also used for pharmacological purposes, such as for pain relief or for treatment of epilepsy.
    Formule :C15H24N2O7S
    Degré de pureté :Min. 95%
    Masse moléculaire :376.43 g/mol

    Ref: 3D-ILC-4368-V

    1piece
    784,00€
  • H-LGPGQSKVIG-NH2


    Peptide H-LGPGQSKVIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43452

    ne
    À demander
  • Fluor-Y-OH


    Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44632

    ne
    À demander
  • H-WMDF^-NH2


    Peptide H-WMDF^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Masse moléculaire :606.7 g/mol

    Ref: 3D-PP42703

    ne
    À demander
  • H-AMHVAQPAVVLASSR^-OH


    Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47365

    ne
    À demander
  • HIV-1 Nef 92-100 (HLA-B*40:01)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50736

    ne
    À demander