Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29796 produits trouvés pour "Peptides"
H-HLEDVFSK^-OH
Peptide H-HLEDVFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPK^PQQFFGLM-NH2
Peptide H-RPK^PQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SGQGSFQPSQQN-NH2
Peptide Ac-SGQGSFQPSQQN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Asn-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block for the synthesis of peptides. It is a resin that contains amines, thiols, and alcohols. The resin has a particle size of 100 to 200 mesh and contains 1% DVB.Degré de pureté :Min. 95%Ac-GQVGRQLAIIGDDINR-NH2
Peptide Ac-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Amyloid (1-42), human
Custom research peptide; min purity 95%.
Formule :C203H311N55O60SDegré de pureté :Min. 95%Masse moléculaire :4,514.1 g/molH-VAAEDWK^-OH
Peptide H-VAAEDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 Antigen Peptide NCAP (AFFGMSRIGMEVTPSGTW)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C89H132N22O25S2Masse moléculaire :1,974.37 g/molH-FNVWDTAGQEK^-OH
Peptide H-FNVWDTAGQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Gly-Gly-Gly-Arg-Gly-Asp-Ser-Pro-OH
Gly-Gly-Gly-Gly-Arg-Gly-Asp-Ser-Pro is a peptide used as an activator in research. It can be used to study protein interactions and the effects of ligands on ion channels and receptors. Gly residues are able to form hydrogen bonds, which is why they are often used as spacers in proteins. This peptide has a high purity and CAS number.
Formule :C28H46N12O13Degré de pureté :Min. 95%Masse moléculaire :758.75 g/molH-KHNLGHGHKHERDQGHGHQR-NTBiot
Peptide H-KHNLGHGHKHERDQGHGHQR-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLAVTDSPAR^-OH
Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SA^VTALWGK^-OH
Peptide H-SA^VTALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELPLYR^-OH
Peptide H-ELPLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAVYHHFISDGVR^-OH
Peptide H-AAVYHHFISDGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Synthetic SAA1 (1-76) protein (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :8,575.21 g/molAc-CESLEQEAAN-OH
Peptide Ac-CESLEQEAAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Ile-Glu-Thr-Asp-AMC
CAS :Ac-Ile-Glu-Thr-Asp-AMC is a reactive, nonsteroidal anti-inflammatory drug that inhibits the activity of survivin, which is an important protein for the survival of prostate cancer cells. Ac-Ile-Glu-Thr-Asp-AMC also inhibits mitochondrial membrane potential in prostate cancer cells and normal peripheral blood mononuclear cells, leading to apoptosis. The biochemical properties of Ac-Ile-Glu-Thr-Asp-AMC are similar to those of other NSAIDs. This drug has been shown to inhibit protein synthesis in experimental models and hydrochloric acid causes mitochondrial membrane depolarization, which triggers apoptosis.Formule :C31H41N5O12Degré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :675.68 g/mol(2S)-2-[[(2S)-5-Amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutan oyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]acetyl]amino]-5-oxopentanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-(1H-
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C58H78N14O14Masse moléculaire :1,195.35 g/molTachyplesin III
Tachyplesin is a type of cationic β-hairpin antimicrobial peptide (AMP) discovered from horseshoe crab hemocytes. This product has disulfide bonds between Cys3-Cys16, Cys7-Cys12 and is available as a trifluoroacetate salt. One letter code: H-KWCFRVCYRGICYRKCR-NH2Formule :C99H151N33O19S4Degré de pureté :Min. 95%Masse moléculaire :2,235.77 g/molSendai Virus Nucleoprotein (SV9), 324-332
Custom research peptide; min purity 95%.
Formule :C46H64N10O12Degré de pureté :Min. 95%Masse moléculaire :949.08 g/molSIVmac239 - 28
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,636.9 g/molH-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB
For preparation of acids, alcohols, thiols, or aminesDegré de pureté :Min. 95%Influenza Matrix Protein M1 (58-66)
Influenza Matrix Protein M1 (58-66) is a peptide that is derived from influenza virus peptide 58-66. It has cytotoxic effects on lymphocytes and inhibits H-Gly-Ile-Leu-Gly-Phe-Val-Phe-Thr-Leu, which is the sequence of an enzyme called CEF1. Influenza Matrix Protein M1 (58-66) is a biologically active peptide that can be used as a cancer drug or for the treatment of infectious diseases.
Formule :C49H75N9O11Degré de pureté :Min. 95%Masse moléculaire :966.2 g/molSuc-Glu-Ala-Leu-Phe-Gln-pNA
Suc-Glu-Ala-Leu-Phe-Gln-pNA is a substrate for human rhinovirus 3C protease. The peptide is a mixture of four amino acids and has been synthesized to serve as an inhibitor of the HRV3C protease enzyme. Suc-Glu-Ala-Leu-Phe-Gln-pNA is expected to inhibit the HRV3C protease by binding to the active site, thereby preventing cleavage of viral proteins that are needed for replication.Formule :C38H50N8O13Degré de pureté :Min. 95%Masse moléculaire :826.87 g/molProTx-II
CAS :ProTx-II is a synthetic peptide that activates the TRPV1 receptor, a member of the capsaicin receptor family. ProTx-II has been shown to inhibit NGF-induced neurite outgrowth, and can be used as a research tool in studying the structure and function of TRPV1 receptors. ProTx-II is also an inhibitor of protein interactions with the TNF receptor, and has been shown to selectively inhibit NFκB activation by inhibiting IKK kinase activity.Formule :C168H250N46O41S8Degré de pureté :Min. 95%Masse moléculaire :3,826.6 g/molH-FTDEYQLYEDIGK^-OH
Peptide H-FTDEYQLYEDIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-ENPVVHFFKNIVTPR-OH
Peptide LCBiot-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Kisspeptin-13 (human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C78H107N21O18Masse moléculaire :1,626.84 g/molH-AQQHYPVSAGYTK^-OH
Peptide H-AQQHYPVSAGYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Asp(OtBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Asp(OtBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB is a tool for peptide synthesis. It contains a set of building blocks including thiols, alcohols, amines, and resin. The resin is used as the solid support for peptide synthesis. The thiols react with the resin to form a covalent bond that anchors the building blocks to the solid support. The alcohols and amines can be reacted with amino acids or other activated carboxylic acids to synthesize peptides on this type of resin.Degré de pureté :Min. 95%H-RASTIEMPQQAR^-OH
Peptide H-RASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.DOTA-GRRRRRRRRRRR-OH
Peptide DOTA-GRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVLATGLR^-OH
Peptide H-LVLATGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-MHRQETVDCLKKFN-NH2
Peptide Biot-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 121 (VFTWPPWQAGILARN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,756.1 g/molH-VTSPNITVTLK^-OH
Peptide H-VTSPNITVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSLFIPIR^-OH
Peptide H-DSLFIPIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 75
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,891 g/molMART-1 26-35 (HLA-B*35:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-YTIAALLSPYSYSTTAVVTNPK^-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Desmin , human, recombinant
Desmin, human, recombinant is a protein that is commonly used in research studies. It is produced using E.coli as the host organism. Desmin plays a crucial role in maintaining the structural integrity of muscle cells. It forms a network of intermediate filaments that provide support and stability to muscle fibers. This recombinant form of desmin is often used in experiments to study its function and interactions with other proteins. Researchers can use this protein to gain insights into various cellular processes and mechanisms related to muscle development, contraction, and disease. Its high purity and quality make it an ideal choice for scientific investigations requiring reliable and consistent results.Degré de pureté :Min. 95%DOTA-(Tyr3)-Octreotate acetate salt
CAS :Produit contrôléOctreotate is a radiopharmaceutical that is synthesized by reacting DOTA-Tyr3 with octreotide acetate. Octreotate, also known as dotatate, is used in nuclear medicine to treat neuroendocrine tumours. This drug has a high yield and can be reliably prepared using cassettes and computerised equipment to create germanium-68 labelled octreotate. The radionuclide emits positrons and gamma rays, which are used for imaging neuroendocrine tumours in the brain or other organs. Octreotate is a synthetic analogue of the natural hormone octreotide, which binds to receptors on the cell surface and prevents the release of hormones from cells. This may be due to its ability to inhibit protein synthesis by inhibiting rRNA synthesis.
Formule :C65H90N14O19S2Degré de pureté :Min. 95 Area-%Couleur et forme :White Slightly Yellow PowderMasse moléculaire :1,435.63 g/mol(Asn(4-aminobutyl)1·7·23,Gln(4-aminobutyl)3·11·22)-Amyloid b-Protein (1-40) trifluoroacetate salt
Please enquire for more information about (Asn(4-aminobutyl)1·7·23,Gln(4-aminobutyl)3·11·22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C218H355N65O52SDegré de pureté :Min. 95%Masse moléculaire :4,750.62 g/molH-HVGDLGNVTADK^-OH
Peptide H-HVGDLGNVTADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVVGAVGVGK^-OH
Peptide H-VVVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGVDDAFYTLVR^-OH
Peptide H-QGVDDAFYTLVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
prepro-Endothelin 1 (ET-1) (169-212) / PSW44 (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :5,291.87 g/molHXB2 gag NO-73
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,961.2 g/molH2N-Pro-Arg-Pro-Arg-Pro-Arg-Pro-Arg-Pro-Arg-Pro-Ar
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C220H382N100O41Masse moléculaire :5,084.03 g/molH-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH
H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C200H377N125O51Masse moléculaire :5,349 g/molH-LPEATPTELAK^-OH
Peptide H-LPEATPTELAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Couleur et forme :PowderSIVmac239 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,476.7 g/molCMVpp65 - 59 (EDVPSGKLFMHVTLG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,629.9 g/molFmoc-Gln(Trt)-Rink-Amide MBHA Resin
Fmoc-Gln(Trt)-Rink-Amide MBHA Resin is a peptide resin that can be used as an activation and coupling agent for the synthesis of peptides. It is also used in the production of antibodies, and has been shown to inhibit ion channels. Fmoc-Gln(Trt)-Rink-Amide MBHA Resin is a high purity material with a CAS number, which can be used in research tools, cell biology, and pharmacology.Degré de pureté :Min. 95%HXB2 gag NO-98
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,663 g/molH-LFLAEFQSIPR^-OH
Peptide H-LFLAEFQSIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.beta-Casomorphin (1-2)
CAS :Beta-casomorphin (1-2) is a peptide that has been identified as a possible endogenous ligand for opioid receptors. It is a product of the breakdown of casomorphin, a milk protein found in dairy products such as cheese and yogurt. Beta-casomorphin (1-2) has been shown to bind to human immunodeficiency virus type 1 receptors and may play an important role in the pathogenesis of human immunodeficiency virus type 1 infection. This peptide also inhibits bacterial growth by binding to bacterial ribosomes, preventing the formation of new proteins, which leads to cell death. Beta-casomorphin (1-2) has been shown to have an inhibitory effect on blood pressure and its antihypertensive activity may be due to its ability to stimulate the release of nitric oxide from endothelial cells.Formule :C14H18N2O4Degré de pureté :Min. 97 Area-%Couleur et forme :PowderMasse moléculaire :278.3 g/molH-APAMFNIR^-OH
Peptide H-APAMFNIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-PPPPPP
Peptide Biot-PPPPPP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPGFSPFR^-OH
Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LESLLEEK^-OH
Peptide H-LESLLEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Nesfatin-1 (Human)
Nesfatin-1 is a peptide hormone that is synthesized in the brain, pancreas, and gut. It can be found in human plasma and cerebrospinal fluid. Nesfatin-1 has been shown to decrease food intake through its effects on the hypothalamus. This peptide hormone also stimulates insulin secretion from pancreatic beta cells, which may be due to its ability to inhibit the release of glucagon. Nesfatin-1 has been shown to have a strong effect on glucose homeostasis and may be used as an adjunct therapy for diabetes mellitus type 2 patients who are resistant to metformin treatment.Formule :C427H691N113O134Degré de pureté :Min. 95%Masse moléculaire :9,551.95 g/molWang Resin (100-200 mesh) 1% DVB
Unsubstituted Resins for Solid Phase SynthesisDegré de pureté :Min. 95%H-EFIAWLVK^-OH
Peptide H-EFIAWLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAPVNISSSDLTGR^-OH
Peptide H-GAPVNISSSDLTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Kisspeptin-10 TFA salt
CAS :Kisspeptin-10 is a peptide hormone that belongs to the family of kisspeptins. It is an intracellular regulator of calcium, which plays an important role in the regulation of cell growth and differentiation. The effect of kisspeptin-10 on cytosolic calcium levels can be used as a potential drug target for cancer treatment. It has been shown that kisspeptin-10 inhibits ovarian activity by reducing the production of luteinizing hormone (LH) and follicle stimulating hormone (FSH). Kisspeptin-10 also regulates bone metabolism by inhibiting osteoblasts and promoting osteoclasts, leading to increased bone resorption.Formule :C63H83N17O14•xC2HF3O2Degré de pureté :Min. 95 Area-%Couleur et forme :White Off-White PowderMasse moléculaire :1,302.44 g/molAc-CISQAIPKKKKVLE-OH
Peptide Ac-CISQAIPKKKKVLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NNHTASILDR^-OH
Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SV^^LGQL^GITK^-OH
Peptide H-SV^^LGQL^GITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQVSLTCLVK^-OH
Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.IGF1 N15 Human
IGF1 N15 Human is a desiccated, freeze-dried protein that is stable isotope and suitable for use in metabolic studies. IGF1 N15 Human has the same amino acid sequence as human insulin-like growth factor 1 (IGF1). IGF1 N15 Human can be used to study cell proliferation, sulfation, and sulfate conjugation. This protein is also used in Cytokines research as an alternative to recombinant human IGF1. Reconstitute with water or buffer prior to use.Degré de pureté :>97% By Sds-Page And Rp-Hplc.H-SAYVSYDVQK^R^-OH
Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITAHVEPLLAR^-OH
Peptide H-LITAHVEPLLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Thr-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-NH2
This peptide is a PAR1-specific agonist that has been shown to produce cardioprotective effects in experimental models of myocardial infarction. It is a potent inhibitor of platelet aggregation and coagulation, and was found to be an effective antithrombotic agent in animal models. The peptide is also a potent vasodilator with potential for the treatment of hypertension.Formule :C54H89N17O15Degré de pureté :Min. 95%Masse moléculaire :1,215.67 g/molLCBiot-LEVFYNGAWGTVGK-OH
Peptide LCBiot-LEVFYNGAWGTVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuromedin U-23 (rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formule :C124H180N34O31Masse moléculaire :2,643 g/molAc-RYDLGGAGMVC-NH2
Peptide Ac-RYDLGGAGMVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
DNA Topoisomerase-I , human, recombinant
This enzyme belongs to the family of isomerases, and is a type of glycosylated enzyme. The recombinant DNA topoisomerase-I has been expressed in E. coli cells, purified through chromatography and characterized by mass spectroscopy. It is an enzyme that catalyzes the breakage and rejoining of one DNA strand in order to relieve torsional strain between two strands. In addition to its function as an enzyme, it can be used as a food additive or a technique for molecular biology.Degré de pureté :Min. 95%H-DPIYFTGLASEPGAR^-OH
Peptide H-DPIYFTGLASEPGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ghrelin (Human, Rat, 1-10)
Amino acids 1-10 of the peptide hormone Ghrelin which is found in the stomach, brain and other tissues and plays a key role in regulating energy balance. Ghrelin associates with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. As a result it is able to influence the body in various ways such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.
Formule :C55H84N14O17Degré de pureté :Min. 95%Masse moléculaire :1,213.37 g/molH-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LL-37 amide
CAS :LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.Formule :C205H341N61O52Masse moléculaire :4,493.3 g/molSIVmac239 - 59
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,479.5 g/molH-VNSAAFPAPIEK^-OH
Peptide H-VNSAAFPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVSVLTVTHQDWL^NGK-OH
Peptide H-VVSVLTVTHQDWL^NGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2
Peptide H-YARAAARQARAHPRNPARRTPGTRRGAPAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Psalmotoxin 1
CAS :Psalmotoxin 1 is a peptide that is an activator of ion channels. It has been shown to bind to the acetylcholine receptor, nicotinic acetylcholine receptor, and the glycine receptor. It also inhibits protein interactions with its high-affinity binding affinity for the alpha-subunit of phospholipase A2.Formule :C200H318N62O57S6Degré de pureté :Min. 95%Masse moléculaire :4,695.42 g/molGag (18-26) [Human immunodeficiency virus type 1] acetyl/amide
CD8+ T-cell (cytotoxic T lymphocyte (CTL)) responses are important in the control of viral replication. Inducing a sustained HIV-1 specific CD8+ T-cell response is the target for vaccine development by using conserved HIV-1 epitopes. The HIV gag gene encodes p17 and p24. P17 Gag is a matrix protein that is vital to HIV life cycle, use of p17 Gag epitopes is a possibility for HIV therapies. P17 Gag targets viral RNA to the nucleus and Gag polyproteins to the cell membrane- p17 Gag accumulates in the extracellular space of tissue while interacting with receptors on various cell types to deregulate cell function.CTL recognition epitope of p17 Gag is identified as residues 77-85 to activate the immune response. Within Gag p17 is the conserved/persistently recognised epitope KIRLRPGGK (amino acids 18-26). This sequence has been used as an effective epitope in immunological assays to assess CTL response work has also shown patients targeting conserved or variable Gag epitopes including Gag p17 (18-26) effects the strength of CD8+ T-cell response and disease progression.Masse moléculaire :1,064.7 g/molThyroglobulin (Tg-VIF)
Thyroglobulin (Tg) is a widely used biomarker of various differentiated thyroid cancer (DTC)- Tg is a substrate for thyroid hormone production. Detection and quantification of serum thyroglobulin levels remain challenging due to Tg's size, heterogeneity, and thyroglobulin autoantibodies (TgAb). Immunoassays offer the opportunity to tailor DTC treatments, but many patients are TgAb positive, excluding them from analysis during regression.Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can overcome immunoassay issues by digestion of Tg to a tryptic peptide removing the interference from TgAbs.Masse moléculaire :1,270.7 g/molH-V^YIHPF-OH
Peptide H-V^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PTPRN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRN antibody, catalog no. 70R-6312Degré de pureté :Min. 95%SIVmac239 - 16
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,509.8 g/molH-TFDEIASGFR^-OH
Peptide H-TFDEIASGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVNVSSIMSVR^-OH
Peptide H-VVNVSSIMSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CDLIKALGSPSVLP-NH2
Peptide Ac-CDLIKALGSPSVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 66 (QPFMRPHERNGFTVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,829.1 g/molAc-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2
Peptide Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIYKRWII^-OH
Peptide H-EIYKRWII^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEGPGEQETK^-OH
Peptide H-LEGPGEQETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Gag (18-26) [Human immunodeficiency virus type 1] acetyl/amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1001214.webp&w=3840&q=75)
