Peptides

Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.

Peptide H-ADHVSFNGYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-STGGAPTFNVTVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Peptide H-NTTGALTTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Crotonic-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LGADMEDV^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Pr-EIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LNALKPDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SFSLSTNLQESLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SSATTFRLLWENGNLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GIYDGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.

Peptide Ac-DERAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DLYSGLNQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-CDLIKALGSPSVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KALNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LGPLV^EQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GHIISLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EFNNLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LNENIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LTSTVQL^IM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IYNSVFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Biot-KDGATMKTFCGTPEY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-CGPENGRRGGFGSRG-NH2 PAB-207-1713 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The BH3 BIM (52-71), human peptide is a synthetic peptide derived from the BIM protein (Bcl-2-like protein 11), which is a member of the BH3-only family of pro-apoptotic proteins. This specific peptide corresponds to amino acids 52 to 71 of the human BIM protein, and it contains the BH3 domain—a critical region responsible for its interaction with anti-apoptotic members of the Bcl-2 family, such as Bcl-2, Bcl-xL, and Mcl-1.
The BH3 domain is essential for the pro-apoptotic function of BIM. It binds to anti-apoptotic proteins, neutralizing their activity and allowing pro-apoptotic proteins like Bax and Bak to promote mitochondrial outer membrane permeabilization (MOMP), which leads to apoptosis (programmed cell death). This mechanism is crucial in regulating cell death, especially in cancer and other diseases where apoptosis is dysregulated.

Peptide H-WTLTAPPGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-IRIKIRIK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-CETVSTQELYS-NH2 PAB-403-404C6 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IIWDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.

Peptide 5Fam-KGYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-VVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SNTSESF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Leu-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block for the synthesis of peptides. It may be used in the synthesis of amines, thiols, alcohols, and resin. This product can also be used as a tool for peptide synthesis.

Ac-Leu-Glu-His-Asp-H (aldehyde) is a research tool that is used in the study of ion channels and receptor proteins. It can be used to activate a receptor or ligand, or to inhibit them. Ac-Leu-Glu-His-Asp-H (aldehyde) can also be used as an antibody to identify peptides and proteins. This product has high purity and is intended for use in pharmacology and life science research.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide LCBiot-DAEFRHDSGYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-CISQAIPKKKKVLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-ε-Aca-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block used in the synthesis of peptides. This resin has been designed to be compatible with amines, thiols, and alcohols, which are important for peptide synthesis. H-ε-Aca-2-ClTrt Resin (200-400 mesh) 1% DVB is an acid form of the amino acid Dde. It can be used for the preparation of solid phase peptide synthesis and for the purification of peptides after cleavage from the resin.

Peptide H-VNSV^IEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KKRRPVKVYP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MLTELEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ANEILASVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

EDDnp is a potent and selective inhibitor of the proteolytic enzyme dipeptidyl peptidase IV (DPP-IV). EDDnp binds to the active site of DPP-IV, which prevents it from cleaving peptides at the carboxy terminus. The inhibition of DPP-IV results in an increase of peptide hormones such as glucagon-like peptide 1 (GLP-1) and gastric inhibitory polypeptide (GIP), which are involved in regulating blood glucose levels. In addition, there are high values of EDDnp in human serum and urine, which may be due to its function as a potential biomarker for diabetes. The physiological function of EDDnp is still being investigated.

Peptide Abz-QPMAVVQSVPQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FTDEYQLYEDIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Secondary SIL peptide for Rituximab detection and quantification

Peptide Fmoc-AAGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LLDNWDSVTSTFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-Asn(Trt)-Wang resin is a resin that is used for solid phase peptide synthesis. It is a polystyrene with an amino acid sequence of Asn(Trt) and Wang. This resin can be used as a research tool to study receptor-ligand interactions, protein interactions, and peptide synthesis. It has been shown to be an excellent high-purity reagent for antibody production. Fmoc-Asn(Trt)-Wang resin has also been shown to inhibit the activation of ion channels by binding to the receptor site on the channel protein.