Peptides

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Omega-conotoxin MVIIA is a peptide that is an activator of voltage-gated calcium channels. It is an inhibitor of the L-type calcium channel and can be used to study protein interactions in cell biology. Omega-conotoxin MVIIA has been shown to have binding affinity for the nicotinic acetylcholine receptor, which belongs to the class of ligand-gated ion channels. This toxin has also been used as a research tool in pharmacology and antibody production. Omega-conotoxin MVIIA has a molecular weight of 3,411 daltons, with purity greater than 95%. CAS No. 107452-89-1

The outer membrane of gram-negative bacteria contains lipopolysaccharides (LPS) composed of lipid A. Lipid A is produced from the tetra-acylated precursor molecule, lipid IVA. As a part of a host's innate immune response there are toll-like receptor 4 (TLR4) and MD-2 which are expressed on immune cells. TLR4 and MD-2 recognize LPS leading to the activation of NFκB and pro-inflammatory cytokine production. Studies have suggested lipid A in Escherichia coli to be an agonist for both mouse and human TLR4, while lipid IVA can induce species specific TLR4 responses. For example for horse and mouse TLR4 and MD-2, Lipid IVA is an agonist where as it is an antagonist for TLR4 and MD-2 in humans.

Fmoc-Leu-OH is a fatty acid that has been shown to be effective in treating inflammatory diseases such as skin cancer. It has also been shown to have neuroprotective and anti-inflammatory activities, which may be due to its ability to inhibit the nitrite levels in diabetic patients. Fmoc-Leu-OH has been shown to increase insulin sensitivity and decrease insulin resistance in diabetic patients. This drug may also have an effect on cancer by inhibiting the growth of tumor cells and inducing apoptosis.

GsMTx-4 is a peptide that is an inhibitor of the G protein. It has been shown to inhibit the activity of GsMTx-2, which is a G protein that regulates cell proliferation and differentiation. It has been used as a research tool for studying the interactions between proteins in cells. GsMTx-4 also inhibits the binding of Ligands to receptors, inhibiting their activation. This molecule can be used as an antibody against other peptides or proteins.

H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

BNP-32 is a peptide that has been shown to activate G-protein coupled receptors and ion channels. It is known to be an agonist of the receptor for bradykinin and vasoactive intestinal peptide, as well as the receptor for neurotensin, which is a member of the tachykinin family. BNP-32 can also inhibit ligand binding to some receptors, such as those for calcitonin gene-related peptide (CGRP) and substance P (SP). BNP-32 has been used as a research tool in cell biology and pharmacology.

Peptide H-NAINNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Dap(Dnp)-NH2 is a synthetic peptide that binds to the toll receptor. The binding of this peptide leads to the signal pathways, which are responsible for the body formation. Abz-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser Arg Dap (Dnp) -NH2 has been shown to have an antiinflammatory effect in rats. This peptide also has a dna binding activity and can be used as a marker for granule neurons in the brain.

Peptide H-VAGFNLLMTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLQWAKKGYYTMKSN-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

PyBOP is an acyclic nucleoside phosphonate that is structurally similar to cyclic peptides and coumarin derivatives. It has been shown to be active against infectious diseases such as malaria and hepatitis C, as well as metabolic disorders such as obesity. PyBOP also has a number of physiological effects, including thermal expansion and immunomodulation. PyBOP binds to the 3'-hydroxyl group of RNA by hydrogen bonding interactions in vivo and inhibits rRNA synthesis, leading to the inhibition of protein synthesis. This drug also disrupts the disulfide bond between cysteine residues in proteins, which may lead to autoimmune diseases. PyBOP is water-soluble and highly soluble in organic solvents, but not soluble in water or polar solvents such as DMSO or acetone. br>br> The thermal expansion coefficient for PyBOP is about 10^6 K^-1mol^

Boc-His(Tos)-OH is an activating reagent for solid-phase peptide synthesis. It can be used as a building block for the synthesis of peptide chains on a solid support. Boc-His(Tos)-OH is typically used in conjunction with other reagents, such as Fmoc-amino acids and DCC, to synthesize amino acid sequences on the surface of the resin. This reagent is often used in high-throughput peptide synthesis protocols.

Fmoc-Gln(Trt)-OH is a synthetic, acid-stable, antimicrobial peptide that can be used as an analytical reagent. It has been shown to inhibit the growth of mammalian cells and bacterial cells in vitro by binding to nicotinic acetylcholine receptors. Fmoc-Gln(Trt)-OH contains sequences that are found in microbial proteins, suggesting that it may have antimicrobial activity against bacteria. The chemical diversity within this molecule may also contribute to its antimicrobial activity.

Peptide H-IGGIGTVPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

BOP Reagent is a reagent that reacts with the phosphate group of dinucleotide phosphates, such as those found in DNA and RNA. It can be used for structural analysis and to determine the presence of nucleic acids in human serum or other biological samples. The BOP Reagent binds to the phosphate group by means of intramolecular hydrogen bonding. This reaction generates a transient, covalently-bound enzyme-substrate complex that can be detected by fluorescence probe.

Boc-Glu(OcHex)-OH is a peptide inhibitor that is used in research to study the effects of protein interactions. Boc-Glu(OcHex)-OH binds specifically to the receptor and blocks ligand binding, preventing activation. This drug is an ion channel activator and an antibody against this drug has been developed. Boc-Glu(OcHex)-OH is soluble in water at ambient temperatures and has a purity of 99%.

Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-Leu-OH • 2O is a monomer for the synthesis of peptides. It is hydrophobic and can be used as a polymer matrix for the synthesis of polypeptides. Boc-Leu-OH • 2O is obtained from nature and can be prepared by hydrolysis of chloroformate ester or hydrogen chloride in dioxane.
Boc-Leu-OH • 2O has been shown to have chiral properties and can be detected using microscopy, dichroism, or amino acid analysis.

Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FNWYVDGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.
The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.
The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials.

Ac-Tyr-Val-Ala-Asp-H (aldehyde) is a peptide that inhibits the activity of protein tyrosine phosphatases, which are enzymes that remove phosphate groups from proteins. This agent binds to the amino acid side chains of an enzyme and prevents it from binding to its substrate. Ac-Tyr-Val-Ala-Asp-H (aldehyde) is a research tool that can be used in life sciences as an inhibitor or activator for peptides, receptors, and ion channels. Ac-Tyr-Val-Ala-Asp-H (aldehyde) has been shown to be active in the inhibition of protein tyrosine phosphatase 1B and 2A isoforms.

Guanylin peptide hormone which is an activator of the transmembrane receptor Guanylate Cyclase C located on the surface of intestinal epithelial cells. It is sourced from Rat, Mouse species and contains disulfide bonds between Cys4-Cys12 and Cys7-Cys15.

Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Fmoc-D-Asp(OtBu)-OH is a cell biology research tool that can be used to study protein interactions and ion channels. It also has been used as an inhibitor for the activation of receptor tyrosine kinases, including human epidermal growth factor receptor 2 (HER2) in breast cancer cells. Fmoc-D-Asp(OtBu)-OH is a high purity compound that is available with CAS No. 112883-39-3.

Peptide H-VYIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MDLEKNYPTPRTSRTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Ala-Tyr-Pro-Gly-Lys-Phe-OH is a peptide that activates toll-like receptor 4 (TLR4). It is a potent inhibitor of the enzyme phospholipase A2 and has been shown to inhibit the production of proinflammatory cytokines, such as IL1β, IL6, IL8, and TNFα. This peptide also has anti-inflammatory effects on autoimmune diseases, such as rheumatoid arthritis. H-Ala-Tyr-Pro-Gly-Lys-Phe-OH has been shown to inhibit prostate cancer cell growth in vitro and in vivo. It appears to exert its action by interfering with the transcriptional process at the level of RNA polymerase II. The mechanism may involve inhibition of the activation of basic fibroblast cells or suppression of epidermal growth factor signaling. H-Ala-Tyr - Pro - Gly - Lys - Phe -

Peptide H-VPQTPLHTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Z-Gln-Gly-OH is a synthetic dipeptide, which is a modified amino acid sequence commonly used in biochemical applications. It consists of a carbobenzoxy-protected glutamine and a glycine residue. This compound originates from custom organic synthesis, derived through specific chemical protocols to introduce protective groups that block reactive sites on the amino acids. This controlled modification alters the peptide's stability and solubility.The mode of action involves the protection of active sites during complex syntheses, enabling the sequential construction of peptide chains without unintended reactions. This protection is critical in solid-phase peptide synthesis methodologies where precision and specificity of reactions are paramount. The Z-group (benzyloxycarbonyl) ensures the stability of glutamine under various chemical conditions, preventing side reactions that may compromise the integrity of peptide constructs.In research, Z-Gln-Gly-OH finds applications in the design of peptide-based inhibitors, structural studies, and the synthesis of longer chain peptides that mimic biologically relevant structures. The protection strategy allows scientists to develop and manipulate peptides with high fidelity, facilitating advancements in understanding protein functions and interactions in physiological contexts.

H-Phe-Met-Arg-Phe-NH2 acetate is a high quality reagent that is useful in the synthesis of complex compounds. It can be used as an intermediate for the production of fine chemicals and speciality chemicals, as well as being a versatile building block in the synthesis of organic compounds. H-Phe-Met-Arg-Phe-NH2 acetate can also be used to make research chemicals or reaction components.

Gly-Pro is a cyclic peptide that binds to DPP-IV and inhibits proteolytic activity. It has been shown to have inhibitory properties against infectious diseases and cancer tissues, as well as a fluorescence probe for the detection of DPP-IV. Gly-Pro is also a potential inhibitor of neuronal death and has been shown to have structural analysis in the form of molecular docking analysis.

TCTU Reagent is a coupling reagent that is used to synthesize peptides. TCTU Reagent is a building block for peptide synthesis, which can be used to produce peptides of different lengths. TCTU Reagent also has the ability to condense two amino acids together in sequence to form a dipeptide. This reagent has been shown to be compatible with most amino acids, except glycine and tryptophan, and can be used for both automated or manual peptide syntheses.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-D-Lys(Cl-Z)-OH is a synthetic peptide that has been shown to bind to the activator region of the human epidermal growth factor receptor (EGFR). It has also been shown to inhibit ion channels and activate ligand-gated ion channels. This product is a research tool for use in cell biology, pharmacology, and other life science research. Boc-D-Lys(Cl-Z)-OH can be used as an antibody or ligand for a receptor, as well as an inhibitor for protein interactions.

Boc-D-Arg(Tos)-OH is an analytical grade building block for the synthesis of D-amino acids. It is used as a reagent for the synthesis of Boc-protected D-amino acids and as a precursor to other amino acid derivatives. The chemical name is N-[2,6-diaminopimeloyl]glycine ethyl ester hydrochloride. Boc-D-Arg(Tos)-OH is soluble in ethyl acetate and methanol, but not in water or ethanol. This product can be used to synthesize peptides with desired properties.

Boc-Ala-OH is a peptide that is used in the treatment of skin cancer. It has been shown to have antitumor properties, as well as antiviral and antifungal effects. Boc-Ala-OH has been shown to inhibit proteolytic enzymes, such as collagenase and elastase, which are involved in the development of inflammatory diseases. This peptide also binds to human serum albumin with high affinity, which may be an important factor in its therapeutic effect. Boc-Ala-OH inhibits the enzyme activities of neutrophils by binding to their membranes and changing the permeability of these cells, which causes them to release cytotoxic granule contents. This peptide also inhibits squamous cell carcinoma and other types of cancerous cells.

pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Ac-Tyr-Val-Gly is a mitochondrial protein that regulates mitochondrial functions and is involved in the regulation of apoptosis. Ac-Tyr-Val-Gly interacts with nuclear DNA and regulates transcription, translation, and replication. Ac-Tyr-Val-Gly has been shown to be toxic to liver cells; however, it has been shown to have no effect on neuronal death or apoptosis pathway. These effects may be due to its ability to induce proteolytic activity in neurons and its ability to activate proapoptotic proteins such as Bax.

Fmoc-Cys(Pam)2-OH is a building block that can be used in the synthesis of lipopeptides. It is used in the research of vaccines and has been shown to target tumor cells.

Primary SIL peptide for Rituximab detection and quantification

H-Gly-Arg-Gly-Glu-Ser-OH is a monoclonal antibody that binds to the integrin receptor on the surface of fibroblasts. It has been shown to inhibit the angiogenic process in vitro, by reducing the expression of growth factors β1 and VEGF. This antibody also inhibits collagen gel contraction and membrane interactions. The detection time for this antibody is approximately 5 days.